Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threading program | | 20 40
| | |
| Seq | MTYGLLLFLGLTFGLQLMLLVFLLFFFLVWWDQFGCRCENMQL |
1 | 4jppA | 0.02 | 0.02 | 1.00 | 1.50 | DEthreader | | TKMQLDNQKEIAEMQNETQKEIAGIQSATSRQNTKDQVYAQNE |
2 | 4uosA | 0.05 | 0.05 | 1.00 | 1.50 | DEthreader | | KMIEEIKKMLEKAIKKVKEMLEKMIKEIKKMLENGEDSEKKKI |
3 | 3dl8C | 0.11 | 0.09 | 0.81 | 1.65 | SPARKS-K | | KATISVIIFSLAIGVYLWILDLTFTKIISFILSLR-------- |
4 | 2l6wA | 0.08 | 0.07 | 0.86 | 1.27 | MUSTER | | SLPFKVVVISAILALVVLTIISLIILIMLWQKK-----PRYE- |
5 | 1vsgA | 0.05 | 0.05 | 1.00 | 1.33 | DEthreader | | EDDQPKGALFTLQAAASKIQKMRDAALRASIYAEINPVANVGD |
6 | 5fwlE1 | 0.02 | 0.02 | 1.00 | 1.50 | DEthreader | | ASLFRWRHQARVERMEQFQKEKEELDRGCRECKRKVAECRKEL |
7 | 5ijpA | 0.05 | 0.05 | 1.00 | 1.50 | DEthreader | | LLEEDLSDIIADVHDLAKFVQVNYTGFYKIIKKHDRLKPVFTK |
8 | 1mztA | 0.06 | 0.05 | 0.74 | 1.29 | SPARKS-K | | LQASATEYIGYAWAMVVVIVGATIGIKLFKKF----------- |
9 | 2metA | 0.14 | 0.12 | 0.81 | 1.15 | MUSTER | | EKTNLEIIILEGTAVIAMFFWLLLVIILRTVKR--------AN |
10 | 6r3qA | 0.07 | 0.07 | 1.00 | 1.33 | DEthreader | | VSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPAEQLKVS |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|