Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | DRDSCVDKSRCAKYGYYQECQDCCKKAGHNGGTCMFFKCKC |
1 | 1px9A | 0.98 | 0.98 | 1.00 | 2.08 | HHpred | | DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKC |
2 | 1vfjA | 0.09 | 0.07 | 0.80 | 1.00 | DEthreader | | -K---IVA-IV-RPEKLNEVLKALFQAEVR-GLTLRL-ILK |
3 | 6opjA1 | 0.08 | 0.07 | 0.90 | 0.83 | DEthreader | | LYELVK-KDVISLFLVAFAVVGACQALGLRDVHVAEVT--- |
4 | 1chlA | 0.19 | 0.12 | 0.66 | 0.77 | DisCoVER | | ---MCMPC--F--------ARKCDDCCGGKGRGKCYPQCL- |
5 | 1fh3A | 0.22 | 0.20 | 0.90 | 0.76 | MAPalign | | --GYIACVYHC--FPGSSGCDTLCKEKGGTSGHCLACWCNA |
6 | 5nceA | 0.32 | 0.29 | 0.93 | 0.54 | CEthreader | | KTPSGKFKGYCV---NNTNCKNVCRTEGFPTGSCDFRKCYC |
7 | 1px9A | 0.98 | 0.98 | 1.00 | 0.77 | FFAS-3D | | DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKC |
8 | 3eslB | 0.10 | 0.10 | 0.95 | 1.00 | DEthreader | | FLENTYMFGIGTK-LLYEEFSKLLENAQFF-LELLKLYTAP |
9 | 6wtwA | 0.09 | 0.07 | 0.85 | 0.83 | DEthreader | | IL-VLVILLFTHHMALYLPFLTVATAMGAPLLSLLT----- |
10 | 6opjA | 0.08 | 0.07 | 0.90 | 0.83 | DEthreader | | LYELVK-KDVISLFLVAFAVVGACQALGLRDVHVAEVT--- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|