Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | MLQEFNQNQKAKVAVCLNKTNSTDLAWWRTWTSSWWANVYF |
1 | 1ceuA | 0.00 | 0.00 | 0.05 | 0.81 | DisCoVER | | -------------------------------------QA-- |
2 | 4w6vA | 0.10 | 0.10 | 0.98 | 0.83 | DEthreader | | DGGMLPQAIGAGYAALGLLDGQQRA-WYGSILIALGHLSIS |
3 | 5lqwX4 | 0.03 | 0.02 | 0.78 | 0.51 | CEthreader | | -------SRYNITTSLSDNNNP--FVVIGFENHILVKDMNG |
4 | 5myjBS | 0.08 | 0.07 | 0.90 | 0.60 | EigenThreader | | QLFRP----GDTVRVHKVRIQIFEGVVIARINETYTVRKIR |
5 | 1bg1A3 | 0.21 | 0.12 | 0.59 | 0.21 | HHpred | | KFPELNYQLKIKVCIDKDSGDVAA----------------- |
6 | 2pffB | 0.20 | 0.12 | 0.61 | 1.20 | MRFsearch | | ---------GVRVIVAGTLLYKTSKAAQDVWNRA------- |
7 | 4qiwE | 0.07 | 0.05 | 0.68 | 0.13 | FFAS-3D | | --VKSRVIRENKINMTMRQPGLGKFEWIEK----------- |
8 | 5lj3S2 | 0.15 | 0.12 | 0.80 | 0.77 | SPARKS-K | | LLQKYITFEARKLYRRYLELNPQ---SWIEFAMYQT----- |
9 | 5v57A | 0.16 | 0.07 | 0.46 | 0.59 | CNFpred | | ----------------------AGVVWFVVLTYAWHTSFKA |
10 | 1og4A | 0.03 | 0.02 | 0.93 | 0.83 | DEthreader | | HTALAYGSAVDFNRAVEFENQFHYKHLQFTSLIPGY---NC |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|