Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | GKRISITLSDEILEDLEIWAQQRGQTVAGLAALLVEKAVTEAQ |
1 | 1u9pA | 0.19 | 0.19 | 1.00 | 1.33 | DEthreader | | GPQFNIYMGREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEG |
2 | 2gpeD | 0.14 | 0.14 | 1.00 | 1.33 | DEthreader | | TTTMGVKLDDATRERIKSAATRIDRTPHWLIKQAIFSYLEQLE |
3 | 6aefB | 0.02 | 0.02 | 1.00 | 1.16 | MAPalign | | AACVAAGARFSGGVFACAALAEVPVGFDSAARVAQISFDSGKD |
4 | 1u9pA | 0.19 | 0.19 | 1.00 | 1.33 | DEthreader | | GPQFNIYMGREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEG |
5 | 2gpeD | 0.15 | 0.14 | 0.93 | 1.33 | DEthreader | | ---MGVKLDDATRERIKSAATRIDRTPHWLIKQAIFSYLEQLE |
6 | 1p94A | 0.16 | 0.16 | 1.00 | 1.33 | DEthreader | | IKRVNVNFDEEKHTRFKAACARKGTSITDVVNQLVDNWLKENE |
7 | 1u9pA | 0.16 | 0.16 | 1.00 | 0.53 | HHpred | | GPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEG |
8 | 2kelA | 0.07 | 0.05 | 0.67 | 0.61 | DisCoVER | | --VFGIYMDKDLKTRLKVYCAKNNLQLTQAI------------ |
9 | 2cpgB | 0.31 | 0.30 | 0.98 | 0.68 | MRFsearch | | -KRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQE |
10 | 6aefB2 | 0.02 | 0.02 | 1.00 | 1.16 | MAPalign | | AACVAAGARFSGGVFACAALAEVPVGFDSAARVAQISFDSGKD |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|