Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | VLCEVNTCTHWLLGNLCTAANIDILYEEEGKMAQKDAHTECKTF |
1 | 3bt1U3 | 0.03 | 0.02 | 0.84 | 0.61 | DisCoVER | | ECISCGSSDSCERGRHQSLEQCLDVVTH---KDD---RHLRGC- |
2 | 6mw4A | 0.05 | 0.05 | 0.93 | 0.83 | DEthreader | | VSVGTFSMASGIGTGTSSVTLLLIATK---LEIYTYPQGILNLK |
3 | 3gauA6 | 0.07 | 0.07 | 1.00 | 0.66 | CEthreader | | KPCDLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHC |
4 | 2co6B1 | 0.10 | 0.09 | 0.93 | 0.58 | EigenThreader | | VKLAVIYTGAT---LSVSNPIVQSSVKDKSSPAPGGETVCIKAV |
5 | 3muuA | 0.34 | 0.23 | 0.66 | 0.22 | HHpred | | VKCEVSECTYSADGG----ATLQYVSDREGQCP----------- |
6 | 3bt1U1 | 0.26 | 0.14 | 0.52 | 0.67 | MRFsearch | | --CRVEECALG--QDLCRTTIVRLWEE----------------- |
7 | 6xbws | 0.12 | 0.09 | 0.75 | 0.20 | FFAS-3D | | ----------NDSYDTRWAQNFSVAYGEHWVQDLNLTGSFWND- |
8 | 2pjyC | 0.15 | 0.14 | 0.91 | 0.92 | SPARKS-K | | LQCFCHLCT--KDNFTCVTGLCFVSVTETTDK--VIHNSSCIAE |
9 | 3bt1U | 0.24 | 0.14 | 0.57 | 0.51 | CNFpred | | GDCRVEECALGQ--DLCRTTIVRLWEE----------------- |
10 | 6c6nA | 0.03 | 0.02 | 0.84 | 0.83 | DEthreader | | -----PGYVLKLGLGDVEGLDAQVVNGYIP-YPLQVQ-SGRAFI |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|