Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threading program | | 20 40
| | |
| Seq | VLMVVVFVTCVFILITLRLNKFQLQELLYYQYNYIPESLLSVV |
1 | 4alyA | 0.07 | 0.07 | 1.00 | 1.33 | DEthreader | | LETLYNDFEKLTSLKEKWLKDTDDLIDEYNTNPDLVLNDTLRS |
2 | 3m65A2 | 0.10 | 0.09 | 0.98 | 1.50 | DEthreader | | TEDEALMRTLLDHFDQYIKISKKISAETYAAVTDIEEPRMA-D |
3 | 3dl8C | 0.09 | 0.07 | 0.74 | 1.31 | SPARKS-K | | ISVIIFSLAIGVYLWILDLTFTKIISFILSLR----------- |
4 | 3jacA | 0.00 | 0.00 | 1.00 | 1.05 | MAPalign | | GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG |
5 | 4rsiB | 0.05 | 0.05 | 0.98 | 1.33 | DEthreader | | HRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFH-VDTV |
6 | 4y66C | 0.12 | 0.12 | 0.98 | 1.33 | DEthreader | | QKLRNYTDIAKQEANLWTDNIFCLQKYMLTKLQ-MDKKTVSTA |
7 | 3m65A | 0.10 | 0.09 | 0.98 | 1.50 | DEthreader | | TEDEALMRTLLDHFDQYIKISKKISAETYAAVTDIEEPRMA-D |
8 | 5lj3S2 | 0.22 | 0.16 | 0.74 | 1.04 | SPARKS-K | | IVLLQKYITFKLYRRYLELNPQSWIEFAMYQT----------- |
9 | 4y66D | 0.05 | 0.05 | 0.98 | 1.33 | DEthreader | | DADMLTLQKNYKDAMTAWATRRAKCREVIDTLSMVFMDQLGL- |
10 | 4y66C2 | 0.12 | 0.12 | 0.98 | 1.33 | DEthreader | | QKLRNYTDIAKQEANLWTDNIFCLQKYMLTKLQ-MDKKTVSTA |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|