Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | EELQKNYEDIMYVCNMLIIAEDAHFTNVQSCCIATLVFYHVRDFIRI |
1 | 3v9rA | 0.02 | 0.02 | 0.98 | 1.17 | DEthreader | | NDDEDRAQLKARLWIRVEERLVLYTRFINSLLELAYLQLGE-GSDLQ |
2 | 4xgcA | 0.07 | 0.06 | 0.94 | 1.17 | DEthreader | | AVS-GDARRALDICRRATEIADTAAVVTMLHVQQALAEMIAKV-DD- |
3 | 3hfxA | 0.02 | 0.02 | 0.96 | 1.17 | DEthreader | | LIFAMGTSLGLATPLVTECMQGIPH--TLQLDAIIITCWIILNAICV |
4 | 4xgcA2 | 0.07 | 0.06 | 0.85 | 1.17 | DEthreader | | AVS-GDARRALDICRRATEIADTAAVVTMLHVQQALAEMI--A---- |
5 | 6nx2A1 | 0.05 | 0.02 | 0.43 | 0.71 | DisCoVER | | --------------LERLREILERLEENPSEKQI------------- |
6 | 4p1mA | 0.07 | 0.06 | 0.98 | 1.17 | DEthreader | | DALNQAADDLNQRLQDLKERTR-VNEQLVFIAALNISYELAQEKAKT |
7 | 3c18A | 0.04 | 0.04 | 0.96 | 0.49 | CEthreader | | SLSFAKLLRRFQDGRNLFSRGNYYD--AYTHVHHALHHLARLSVLEK |
8 | 3rhaA | 0.02 | 0.02 | 0.89 | 0.62 | EigenThreader | | KAILESIAGFLGSSDLAAEG--YQHV---DGAVRMGQATAARIVEAN |
9 | 4hs2A | 0.13 | 0.11 | 0.81 | 0.23 | HHpred | | --------SVENAAEILILADLHSADQLKTQAVDFINY-HASDVLET |
10 | 4adyA1 | 0.18 | 0.17 | 0.94 | 0.37 | MRFsearch | | ---QLWSEISNELPDIEALYDDDTFSDREAALIASKVYYNLGEYESA |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|