Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | QSSDLNSECDREGGQLQPAERPAQPHHLRPGAPTSLQTEY |
1 | 2lqhB | 0.00 | 0.00 | 0.23 | 0.68 | DisCoVER | | -------SDSLSHSDG------------------------ |
2 | 6rwbA3 | 0.05 | 0.05 | 0.95 | 0.67 | DEthreader | | DNLVINAILKA-I-SLREIAVTELLKNIEKKIHPGTIIKN |
3 | 5xogM | 0.10 | 0.10 | 1.00 | 0.54 | CEthreader | | HDNSVVCTLDKSIGLLECKKCGQRFQAPILSQPIDIYSDW |
4 | 3l5hA4 | 0.12 | 0.12 | 1.00 | 0.70 | EigenThreader | | PPHNLSVINLSSILKLTWTNPPPTRSDLKPFTEYVFEDGK |
5 | 3kcrA | 0.20 | 0.15 | 0.75 | 0.24 | HHpred | | DPKSMAKRIKKSGAFV------P---GIRPGEQTAKYIE- |
6 | 2pffB | 0.14 | 0.05 | 0.35 | 0.97 | MRFsearch | | ---------------------PDDDYGFKQGGGGG----- |
7 | 5w3nA | 0.21 | 0.20 | 0.97 | 0.21 | FFAS-3D | | QSTDTSQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSS- |
8 | 1zvoC2 | 0.11 | 0.10 | 0.90 | 1.33 | SPARKS-K | | SLAKATTRNTGRGGEEKKKEKEKEEQEERETKTPEC---- |
9 | 3v4pB | 0.54 | 0.17 | 0.33 | 0.63 | CNFpred | | ---------------------------LRPGEPQQLQVRF |
10 | 2f8hA1 | 0.08 | 0.07 | 0.97 | 0.83 | DEthreader | | TLLTLLEMRRVIGLGVK-GAAGPDIQAHTADEFVTLLQRV |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|