Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | MSATLSTTLSFEPPLSLLAEPGTWFADTMDFRKKHSVRWYES |
1 | 3ghpA | 0.00 | 0.00 | 0.88 | 0.54 | DisCoVER | | YQVLPTSGELLVSEDYG----PIVQGVHKISEGILNLSRAV- |
2 | 2iwlX | 0.02 | 0.02 | 1.00 | 0.41 | CEthreader | | SFRQDGRIKEVSVFTYHKKDKHYIYVVRILREPSFVFRTFDE |
3 | 6rwbA4 | 0.16 | 0.14 | 0.90 | 0.57 | EigenThreader | | SRLTAQIDTIK----ELYVENIKTHFFLGKTRCQYYWRSGEQ |
4 | 3w9aA | 0.30 | 0.24 | 0.79 | 0.37 | HHpred | | -----GGTERWSTP----FTADTWFAYDIDFTAKTVGLWAST |
5 | 2pffB | 0.28 | 0.19 | 0.69 | 1.15 | MRFsearch | | --FKATHILDFGPGLGVLTHVRVIVAGTLDI----------- |
6 | 3k7cA | 0.19 | 0.12 | 0.62 | 0.13 | FFAS-3D | | -SAKIRVLVLFNNDVFLAKKDRKWLVL--------------- |
7 | 2aujD1 | 0.25 | 0.24 | 0.95 | 0.79 | SPARKS-K | | DDVEVTTGDRVAPG-DVLADGGKVKSVEVDLVRNV-VRVVES |
8 | 4f3nA | 0.04 | 0.02 | 0.67 | 0.58 | CNFpred | | --------------RLVAKQARGWCERGVSIDDAGAFVFADR |
9 | 5cwoA2 | 0.03 | 0.02 | 0.90 | 0.83 | DEthreader | | LVVAAKVAVALVAVAI--EEKQNL-VEVARLK-AIRILVRQG |
10 | 4le3A | 0.22 | 0.21 | 0.98 | 0.53 | MUSTER | | ISDLLRWCVGGQTQWSVEWAADVWVAYEIDFAAGTVGFWH-S |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|