Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | NHQALMAAQSKAVIARFLGDAGMWLQANQQMKQAVSMPWYRR |
1 | 3sf4A | 0.17 | 0.17 | 1.00 | 1.50 | DEthreader | | FDEAIVCCQRHLDISRELNDKVGEARALYNLGNVYHAVFEES |
2 | 4a1sA | 0.07 | 0.07 | 0.98 | 1.50 | DEthreader | | YNKAMQYHKHDLTLAKSMNDRLGEAKSSGNLGNTLKFAAIE- |
3 | 4a1sA5 | 0.24 | 0.21 | 0.90 | 1.05 | MUSTER | | DLRTLSAIYSQLGNAYFY--LGDYNKAMQYHKHDLTL--AKS |
4 | 3ihuA | 0.19 | 0.19 | 1.00 | 1.33 | DEthreader | | SVQALRASVQALVAAEKAQDGETFSNARRHFYRTLLFIEGAA |
5 | 4a1sA | 0.24 | 0.24 | 1.00 | 1.50 | DEthreader | | FQAAIEHHQERLRIAREFGDRAAERRANSNLGNSHIAAHKRA |
6 | 3sf4A | 0.17 | 0.17 | 0.98 | 1.50 | DEthreader | | YAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKFAIVQ- |
7 | 3evlA2 | 0.16 | 0.14 | 0.90 | 0.37 | HHpred | | NNASYWRGQEATIIGVISKDDELFRWGLGRYVQAMGLI---- |
8 | 2hr2A1 | 0.09 | 0.07 | 0.76 | 0.58 | DisCoVER | | ---EVVGAYLALSDAQVAGEYDEAAANCRRAEISH------- |
9 | 4ozvA2 | 0.21 | 0.17 | 0.81 | 0.57 | MRFsearch | | --HSYWAAWSVMSTAVVTNRRDLFDWAVSEFKVAAN------ |
10 | 5an3A2 | 0.10 | 0.10 | 0.95 | 0.97 | SPARKS-K | | DRSKIGLVNFRYFVHFFNIKD--YELAQSYFKKAKNLGYVDD |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|