Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | HAQPRHPAVYSPAAGVLCDRYVCADDQGISRALTERYLGK |
1 | 1df6A | 0.22 | 0.12 | 0.57 | 0.78 | DisCoVER | | -------SCPCTALGCSCSNRVC-----YNGIPC--A--- |
2 | 3g33D1 | 0.03 | 0.03 | 0.97 | 0.83 | DEthreader | | IK-HMKAYMLEVEEQRCVFACMLLKETPLTIEKLCIYTDH |
3 | 1l0qA3 | 0.12 | 0.12 | 1.00 | 0.61 | CEthreader | | AGSSPQGVAVSPDGKQVYVTLSVIDTTSNTVAGTVKTGIA |
4 | 3pqiA2 | 0.07 | 0.07 | 1.00 | 0.53 | EigenThreader | | EVDKQTYASNISQGMKIDMNSIVLTGGGKLTLQGRMTDGL |
5 | 6u75A | 0.19 | 0.12 | 0.65 | 0.25 | HHpred | | ---ISCTRMKYPAKTDQCKHIQCFDALWF----------- |
6 | 2pffB | 0.18 | 0.10 | 0.55 | 0.90 | MRFsearch | | ------------------VRVIVAGTMGMDLYKTSKAAQD |
7 | 3c7uB2 | 0.23 | 0.17 | 0.75 | 0.20 | FFAS-3D | | ----------APSAPTLTLAKFNQVTVGMTRAQVLATVGQ |
8 | 2kyjA | 0.13 | 0.10 | 0.75 | 1.35 | SPARKS-K | | PLSKEYESCVRPRPPLKCNKAICVDPNKGW---------- |
9 | 2bpoA | 0.27 | 0.15 | 0.55 | 0.58 | CNFpred | | ------------------FIYVCGDAKGMAKGVSTALVGI |
10 | 2fhxA2 | 0.11 | 0.10 | 0.93 | 1.00 | DEthreader | | --PYN-LTATKIDSDVFVVTNVLVAKVVIVITVFGVIPGV |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|