Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | GGYAFYVWLSVGMTLLALGCLIIHTLVQRKQLLKEIRQRESRER |
1 | 6iqeA | 0.07 | 0.07 | 1.00 | 1.50 | DEthreader | | SRAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAK |
2 | 6iqeA | 0.07 | 0.07 | 1.00 | 1.67 | DEthreader | | YTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAK |
3 | 2rddB | 0.11 | 0.09 | 0.84 | 1.12 | MUSTER | | SP-----MSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDS-- |
4 | 5lqxV | 0.07 | 0.07 | 1.00 | 1.50 | DEthreader | | ELQKVAVASEAKSVLDSWVRYEAQVRQHEQEQLASTVISKVQSE |
5 | 7jh5A | 0.11 | 0.11 | 1.00 | 1.50 | DEthreader | | TDPATIREALEHAKRRSKEIIDEAERAIRAAKRESERIIEEARR |
6 | 7jg5b | 0.14 | 0.14 | 1.00 | 1.67 | DEthreader | | KEMAEARAQASALRDEARAAGRSVVDEKRAQASGEVAQTLTQAD |
7 | 6b87A | 0.28 | 0.25 | 0.91 | 0.30 | HHpred | | ----LRLQLVLAIFLLALLIVLLWLLQQLKELLRELERLQREGS |
8 | 4gn0A | 0.11 | 0.02 | 0.20 | 0.77 | DisCoVER | | --------IAEGNLEAE--------------------------- |
9 | 2n28A | 0.10 | 0.09 | 0.95 | 0.37 | MRFsearch | | --VALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAE |
10 | 3dl8C | 0.11 | 0.09 | 0.80 | 0.86 | SPARKS-K | | ---------KATISVIIFSLAIGVYLWILDLTFTKIISFILSLR |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|