Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | FMSDESGATAIEYGLIAALIAVVIISAVTALGSTIKTKFNAVVT |
1 | 3kbuB | 0.02 | 0.02 | 1.00 | 1.33 | DEthreader | | DADEVDKHYAGLKDVACERKRKLENMYHLFQLKRETDDLEQWIS |
2 | 2d4yA | 0.05 | 0.05 | 1.00 | 1.33 | DEthreader | | LSNVVKTDAYATLVSDVGNKTSTLKTSSTTQANVVKQLYKQQQS |
3 | 3dl8C | 0.09 | 0.07 | 0.75 | 1.21 | SPARKS-K | | -----------KATISVIIFSLAIGVYLWILDLTFTKIISFILS |
4 | 6b8hb | 0.11 | 0.11 | 1.00 | 1.50 | DEthreader | | SKVESEAFELKQKVELAHEAKAVLDSWVRYEASLRQLEQRQLAK |
5 | 4fm3A | 0.05 | 0.05 | 1.00 | 1.33 | DEthreader | | TESKARLLAEQAELDARLAESKVLTQKSKDQLGELDKSLKRLRK |
6 | 6eunA | 0.09 | 0.09 | 1.00 | 1.33 | DEthreader | | NGQEGFGLGLKKVVTNLTKTVNENKQNVDAKVKAAESEIEKLTT |
7 | 3sokA | 0.26 | 0.20 | 0.80 | 0.28 | HHpred | | -------FTLIELMIVVAIIGILAAFAIPAYNDYIARSQAAE-- |
8 | 4hw9A | 0.14 | 0.02 | 0.16 | 0.91 | DisCoVER | | SLRLHDG------------------------------------- |
9 | 3um7A1 | 0.20 | 0.18 | 0.93 | 0.30 | MRFsearch | | ---DAGRLFCIFYALVGIPLFGILLAGVGRLGSSLRHGIGHIEA |
10 | 1mztA | 0.16 | 0.14 | 0.84 | 0.96 | SPARKS-K | | --AKAAFDSLQASAYIGYAWAMVVVIVGATIGIKLFKKF----- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|