Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | AANPASVFCEEQGGEVVIKDENGGQVGYCKLSDGRLIEEWTFMNE |
1 | 1ausS | 0.05 | 0.04 | 0.89 | 1.00 | DEthreader | | TDLRQVDYLLNNKWVPCLEFETAFIRIIGFDNREVQISFI----- |
2 | 3zxwB | 0.05 | 0.04 | 0.89 | 1.17 | DEthreader | | DIARQIQYAIDQGYHPCVEFNECFIRVVAFDIKQCQMSFI----- |
3 | 6gosD3 | 0.10 | 0.09 | 0.93 | 1.00 | DEthreader | | TDEI-LLALRSE-GDIRIFDITHAVLTLYGTKN-KYSTLWSYICL |
4 | 1rscN | 0.10 | 0.09 | 0.87 | 1.17 | DEthreader | | DIAAQIEYMIEQGFHPLIEFNECYIRVAGFDIKECQTSF------ |
5 | 1fd3A | 0.08 | 0.07 | 0.87 | 0.55 | DisCoVER | | --IGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKK---- |
6 | 1wddS | 0.03 | 0.02 | 0.89 | 1.00 | DEthreader | | VELKQIEYLLRSKWVPCLEFSKAFVRIIGFDVRQVQISFI----- |
7 | 6hq9A | 0.09 | 0.09 | 1.00 | 0.49 | CEthreader | | IWHPGERCLAPSEASIKSITVDGKSFAVVLYADFQERKILKQLQE |
8 | 3wdjA2 | 0.02 | 0.02 | 1.00 | 0.53 | EigenThreader | | GNDLGATFVWATDVLLKLIHPTKEFLYTYMTYVFIEAVDPYAKSV |
9 | 1s21A | 0.22 | 0.16 | 0.71 | 0.23 | HHpred | | --------FLDQGGKVYSDTSGSVEALIVTLPKGRKVPVN----- |
10 | 1npbA | 0.23 | 0.20 | 0.87 | 0.48 | MRFsearch | | --EPLSQRLEQAGVTIWKQNKSEGASFYFLDPDGHKLELHV---- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|