Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threading program | | 20 40
| | |
| Seq | ARYRCCRSQSRSRCYRQRQTSRRRRRRSCQTQRRAMRCCRRRNRLRRRK |
1 | 5tcxA | 0.00 | 0.00 | 0.92 | 1.17 | DEthreader | | LNLKEDHQKI-DDLFGKLYLIAAIVVAVIMIFEMILSMVLSSGIRN--- |
2 | 4fm3A | 0.12 | 0.12 | 1.00 | 1.33 | DEthreader | | ELAYAQIAESYARAEQAELDARLAESKVLTQKSKDQLGELDKSLKRLRK |
3 | 1vx7g | 0.21 | 0.14 | 0.69 | 1.10 | SPARKS-K | | SRYK--KSRAKMRWKWKKKRTRRLQKKRRKMRQRSR------------- |
4 | 5lp2B | 0.06 | 0.06 | 0.98 | 1.33 | DEthreader | | -HNLNLNSPSSLTALAQKMLKNAQSQAEILKLANQVESDFNKLSSGHKD |
5 | 6x88A | 0.07 | 0.06 | 0.94 | 1.17 | DEthreader | | PSEFS-KD-EE-VFKYLFISVLRNHHTSYLYNIESRRSQMLLWSAVEEL |
6 | 4wpcA | 0.06 | 0.06 | 1.00 | 1.17 | DEthreader | | NLKSKLDVSNRFIRPRIVQELKDLILEIDTAMTIQLQKYTIWTENLVLN |
7 | 2e6iA | 0.21 | 0.06 | 0.29 | 0.16 | HHpred | | GKWRCCSQLEKLAT----------------------------------- |
8 | 1mvzA | 0.00 | 0.00 | 0.02 | 0.99 | DisCoVER | | ---------------------------------A--------------- |
9 | 5axwA1 | 0.19 | 0.12 | 0.65 | 0.65 | MRFsearch | | ---------ENNEGRRSKRGARRLKRRRRHRIQRVKKLLFD-------- |
10 | 6az3n | 0.24 | 0.16 | 0.67 | 1.09 | SPARKS-K | | --------GTVSRPRGMRPKWHKKRIKRLKLRRRRMRQRSK-------- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|