COTH results for job id S1411A-S1411B

Submitted Sequence

>PAS
RRQIRQRKRAERALNDQLEFMRVLIDGTPNPIYVRDKEGRMLLCNDAYLDTFGVTADAVL
GKTIPEANVVGDPALAREMHEFLLTRVAAEREPRFEDRDVTLHGRTRHVYQWTIPYGDSL
GELKGIIGGWIDIT

Predicted Secondary Structure

Sequence	RRQIRQRKRAERALNDQLEFMRVLIDGTPNPIYVRDKEGRMLLCNDAYLDTFGVTADAVLGKTIPEANVVGDPALAREMHEFLLTRVAAEREPRFEDRDVTLHGRTRHVYQWTIPYGDSLGELKGIIGGWIDIT
Prediction	CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCSSSSSCCCCCSSSSHHHHHHHHCCCHHHHCCCCHHHHCCCCCHHHHHHHHHHHHHHHHCCCCSSSSSSSSCCCCCSSSSSSSSSSSSCCCCCSSSSSSSSSSC
Conf.Score	96368999999999999999999996299629999599969746599999959499998599868945867889999999999999964897289999985899699999999999998999999999999789

Sequence	RRQIRQRKRAERALNDQLEFMRVLIDGTPNPIYVRDKEGRMLLCNDAYLDTFGVTADAVLGKTIPEANVVGDPALAREMHEFLLTRVAAEREPRFEDRDVTLHGRTRHVYQWTIPYGDSLGELKGIIGGWIDIT
Prediction	CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCSSSSSCCCCCSSSSHHHHHHHHCCCHHHHCCCCHHHHCCCCCHHHHHHHHHHHHHHHHCCCCSSSSSSSSCCCCCSSSSSSSSSSSSCCCCCSSSSSSSSSSC
Conf.Score	96368999999999999999999996299629999599969746599999959499998599868945867889999999999999964897289999985899699999999999998999999999999789

Top 5 Models predicted by COTH


Download COTH_1	Download COTH_2	Download COTH_3	Download COTH_4	Download COTH_5

Top 10 templates generated by COTH

Rank	Template	Align_length	Coverage	Zscore	Seq_id	Confidence	Target-template alignments	Models from Dimeric COTH threading only	Final models by COTH after MUSTER template superposition
1	1oh0A0_1oh0B0	237	0.884	1.970	0.055	low	alignment_1	threading_1	model_1
2	1z6bA0_1z6bB0	250	0.933	1.874	0.088	low	alignment_2	threading_2	model_2
3	2qkpA0_2qkpB0	248	0.925	1.858	0.121	low	alignment_3	threading_3	model_3
4	2it0A0_2it0B0	242	0.903	1.854	0.103	low	alignment_4	threading_4	model_4
5	1c77A0_1c77B0	235	0.877	1.849	0.094	low	alignment_5	threading_5	model_5
6	2h09A1_2h09A2	239	0.892	1.841	0.096	low	alignment_6	threading_6	model_6
7	1qtoA1_1qtoA2	228	0.851	1.831	0.066	low	alignment_7	threading_7	model_7
8	1j3mA0_1j3mB0	234	0.873	1.830	0.120	low	alignment_8	threading_8	model_8
9	2it0A0_2it0C0	249	0.929	1.819	0.080	low	alignment_9	threading_9	model_9
10	1gy6A0_1gy6B0	229	0.854	1.818	0.061	low	alignment_10	threading_10	model_10

(a)	Column 1: The rank of the the template as determined by the Z-score. The template is with the highest Zscore is ranked 1.
(b)	Column 2: Name of the template PDB from which the particular model was generates. Templates are ranked according to the Z-score of the alignment.
(c)	Column 3: The length of the threading alignment between the query sequence and the template.
(d)	Column 4: The coverage of the aligment in calculated by dividing the length of the alignment (previous column) by the total length of the query complex.
(e)	Column 5: Zscore, or statistical significance, of the alignment upon which the ranking of the templates is based. The Zscore used here is the mean Zscore of the alignment of chain 1 only, the alignment of chain 2 only and the alignment of the complex as a whole. For further reading about Z-score please click here.
(f)	Column 6: The sequence identity between the query sequence and the template sequence.
(g)	Column 7: The confidence of the threading alignment is based on the Zscore and is interpolated from the COTH benchmarking results. The confidence is considered High if the Zscore of the alignment is greater than 2.5 or Low otherwise.
(h)	Column 8: The threading alignment between the query sequence and the template.
(i)	Column 9: The models generated from COTH threading alone. These models are generated before the superposition of the MUSTER individual chain templates onto the dimer templates identified by COTH threading.
(j)	Column 10: The final models generated by COTH after superpostion of the MUSTER individual chain templates onto the dimer templates identified by COTH threading.

	Please cite following articles when you use the COTH server:
1.	Srayanta Mukherjee and Yang Zhang. Protein-protein complex structure prediction by multimeric threading and template recombination. Submitted (2010).