Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | QERFPSDLDLDMFNGSLECDVESIIRSELMDADGLDFNFDS |
1 | 2lqhB | 0.62 | 0.49 | 13.95 | 1.13 | MUSTER | | QDLLTSDSLSGSGGGSLECDMESIIRSELMDA--------- |
2 | 2lqhB | 0.62 | 0.49 | 13.95 | 1.28 | HHsearch-2 | | QDLLHSDGGGGSGGGSLECDMESIIRSELMDA--------- |
3 | 3ihpB4 | 0.18 | 0.17 | 5.54 | 1.09 | Neff-PPAS | | ---FPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPL |
4 | 2lqhB | 0.59 | 0.46 | 13.29 | 1.84 | HHsearch | | DSLSHSDGGGGSGGGSLECDMESIIRSELMDA--------- |
5 | 2i3sB | 0.17 | 0.15 | 4.80 | 1.07 | MUSTER | | PERIVFNFNLIYPENDEEFNTEEILAMIK---GLYKVQ--- |
6 | 5lj3S2 | 0.08 | 0.07 | 2.85 | 1.08 | Neff-PPAS | | -----KEAKIVLLQKYITFEARKLYRRYLELNPQSWIEFAM |
7 | 2ztdA2 | 0.07 | 0.07 | 2.95 | 0.91 | SPARKS-K | | -AVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSAL |
8 | 2lqhB | 0.94 | 0.39 | 10.95 | 0.40 | FFAS-3D | | --------------GSLECDMESIIRSELMD---------- |
9 | 2lqhB | 0.61 | 0.46 | 13.27 | 0.68 | HHpred | | -SLSHSDGGGGSGGGSLECDMESIIRSELMDA--------- |
10 | 2l0fB | 0.23 | 0.22 | 6.90 | 1.00 | MUSTER | | KITFPSDIDPQVFYE-LAEAVQKELLAEWKRTGSDFHIGHK |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|