Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | KGRSLMAHIRRTRHIMMPSYRSCFSYSLFASQNKPSNRAL |
1 | 1t1eA3 | 0.27 | 0.23 | 6.90 | 1.11 | MUSTER | | RGDELEAHVERQAAL-APHARVHLEREAFAASHG------ |
2 | 6exnD2 | 0.05 | 0.05 | 2.30 | 1.21 | Neff-PPAS | | --KKNLEMSQRAEMINRSKHAQQEKAVTTDDLDNLVDQVF |
3 | 1t1eA3 | 0.27 | 0.23 | 6.90 | 1.07 | SP3 | | RGDELEAHVERQAAL-APHARVHLEREAFAASHG------ |
4 | 4mhcA5 | 0.00 | 0.00 | 0.93 | 0.96 | SPARKS-K | | SPNTFVSSVE---NLLIVATLFDIYILTISFNDRTHELNI |
5 | 3qq5A2 | 0.22 | 0.20 | 6.30 | 0.21 | FFAS-3D | | KGRLIMPQVHAIREALLVVKERELRYVMENIGMKPK---- |
6 | 2o5aA | 0.08 | 0.05 | 1.98 | 0.23 | HHpred | | ----------VVVHVFHKDERAYYNLEKLWPTVEL----- |
7 | 5h5yA2 | 0.10 | 0.10 | 3.67 | 1.00 | MUSTER | | KLSDIYHDIICEQRLRTEDKRDEYLLNLLEKREISKAQD- |
8 | 5f0eA | 0.14 | 0.07 | 2.55 | 0.56 | CNFpred | | -----------QTDIRWMSESGIIDVFLMLGP-------- |
9 | 2d3qA | 0.16 | 0.12 | 4.17 | 0.33 | HHsearch-2 | | TRCPFGAHVRKT--------NPRQDTFHAMRSSIPYGPET |
10 | 5lqwX9 | 0.19 | 0.17 | 5.65 | 1.00 | Neff-PPAS | | ---SYMEIDPNGRCIILSSVEQNKLCFLVDYAQKLRISSP |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|