Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | PLASSLRIRVQTGTNANGQPIYRVRTYNRVKPEATDQDVYDVAQA |
1 | 4h4nA | 0.14 | 0.13 | 4.53 | 0.91 | SPARKS-K | | PPNSKLKVTFFG---PYNEVITNVSIINQLSTPKCQTITRYPNYT |
2 | 5i8jA | 0.08 | 0.07 | 2.64 | 0.33 | FFAS-3D | | SMSKLTKVTFI-GWFKSGEMFTKDIML-----SGDREEIEWVTV- |
3 | 2xfbB | 0.12 | 0.09 | 3.16 | 0.23 | HHpred | | -GTLKIQVSLQIGIKTDDSHDWTKLRYMD-NHMPAD--------- |
4 | 3kz5E | 0.17 | 0.16 | 5.11 | 1.10 | MUSTER | | HMSS--RHQFAPGAT-KGDKMVLNLDRSRV-PTECIEKIEAILKE |
5 | 1k1qA | 0.08 | 0.07 | 2.67 | 0.75 | CNFpred | | GIPMRITVIAIMED---LDILSKGKKFKHG---ISIDNAYKVAED |
6 | 2e9gA | 0.17 | 0.13 | 4.40 | 0.27 | HHsearch-2 | | PNKAPLRLKLRLTYDHFHQSVQEIFEVNNLPVESWQ--------- |
7 | 4htgA2 | 0.12 | 0.11 | 3.96 | 0.99 | Neff-PPAS | | -EEGNCIFRGLVAS-PDGTKVLETSRKGPYVYEDMVKMGKDAGQE |
8 | 2e9gA | 0.17 | 0.13 | 4.40 | 0.34 | HHsearch | | PNKAPLRLKLRLTYDHFHQSVQEIFEVNNLPVESWQ--------- |
9 | 1ry6A | 0.11 | 0.11 | 3.98 | 0.74 | SP3 | | KNNCTLYIDEPRYK-VDMTKYIERHEFIKVDDTVDNFTVYENTIK |
10 | 5i8jA | 0.08 | 0.07 | 2.67 | 0.36 | PROSPECTOR2 | | SMSKLTKVTFI-GWFKSGEMFTKDIMLSG-----DREEIEWVTVG |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|