YIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTTQLRKEIQLLDENVQDTEKME
EQLDLLSAILDPSK
The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3rj1:O | 94 | 94 | 1.0000 | 1.0000 | 1.0000 | 9.81e-65 | |
2 | 3lju:X | 373 | 44 | 0.1702 | 0.0429 | 0.3636 | 0.19 | 3feh:A, 3fm8:C, 3fm8:D, 3mdb:C, 3mdb:D |
3 | 8h10:A | 1026 | 51 | 0.1383 | 0.0127 | 0.2549 | 4.1 | 8h0y:B, 8h0z:A, 8h10:B, 8h10:C, 7zh1:A, 7zh1:B, 7zh1:C, 7zh2:A, 7zh2:B, 7zh2:C |
4 | 8h0z:B | 1045 | 51 | 0.1383 | 0.0124 | 0.2549 | 4.1 | 8h0x:A, 8h0x:B, 8h0x:C, 8h0y:A, 8h0y:C, 8h0z:C, 8h14:B, 8h14:C, 8h14:A |
5 | 8tc0:B | 1091 | 51 | 0.1383 | 0.0119 | 0.2549 | 4.1 | 8tc0:A, 8tc0:C, 8tc1:C, 8tc1:A, 8tc1:B, 8tc5:C, 8tc5:A, 8tc5:B, 1zv8:A, 1zv8:C, 1zv8:E, 5zvm:A, 5zvm:B |
6 | 1t6c:A | 306 | 70 | 0.1596 | 0.0490 | 0.2143 | 5.6 | 2j4r:A |
7 | 6e5v:B | 447 | 29 | 0.0957 | 0.0201 | 0.3103 | 5.8 | 6bsz:A, 6bsz:B, 6bt5:A, 6bt5:B, 6e5v:A |
8 | 5bv5:D | 327 | 51 | 0.1383 | 0.0398 | 0.2549 | 5.8 | 5bv5:A, 5bv5:C |
9 | 2bam:B | 210 | 35 | 0.0957 | 0.0429 | 0.2571 | 8.6 | 2bam:A, 3bam:A, 3bam:B, 1bhm:A, 1bhm:B, 1esg:A |
10 | 8eti:5 | 340 | 36 | 0.1383 | 0.0382 | 0.3611 | 9.3 | 8eth:5, 8eup:5, 8euy:5, 8ev3:5 |
11 | 2w27:A | 401 | 18 | 0.0957 | 0.0224 | 0.5000 | 9.8 | 2w27:B |