BioLiP

>protein
YGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSTLAYFSATASGDILPIKK
GPQLPPQLGPRLG

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6yez:H	93	93	1.0000	1.0000	1.0000	1.12e-62	7dkz:H, 5l8r:H, 3lw5:H, 4rku:H, 4y28:H, 6yac:H, 6zoo:H, 6zxs:H
2	7wfd:AH	95	91	0.8495	0.8316	0.8681	2.63e-54	8j6z:H, 8j7a:H, 8j7b:H, 2o01:H, 7wfe:BH, 7wg5:AH, 2wsc:H, 2wse:H, 2wsf:H
3	4xk8:H	90	87	0.8495	0.8778	0.9080	2.53e-52	4xk8:h
4	8htu:H	95	91	0.6344	0.6211	0.6484	9.17e-41	7ksq:H, 7kux:H, 6l35:H, 7xqp:H
5	5zji:H	95	80	0.7634	0.7474	0.8875	2.90e-35	8bcv:H, 8bcw:H
6	8wgh:H	90	76	0.6774	0.7000	0.8289	1.40e-31
7	6zzx:H	94	91	0.4624	0.4574	0.4725	2.03e-23	6zzy:H
8	7d0j:H	100	90	0.3763	0.3500	0.3889	3.21e-16	7dz7:H, 7dz8:H, 8h2u:H, 6ijo:H
9	7yca:H	96	92	0.4624	0.4479	0.4674	3.85e-16
10	6sl5:H	92	81	0.3763	0.3804	0.4321	6.26e-14
11	6igz:H	88	86	0.3978	0.4205	0.4302	1.08e-12
12	6tq4:A	297	34	0.1505	0.0471	0.4118	0.39	6tq6:A
13	6tp3:A	314	34	0.1505	0.0446	0.4118	0.40	6to7:A, 6to7:B, 6tod:A, 6tod:B, 6tos:A, 6tos:B, 6tot:A, 6tot:B, 6tp3:B, 6tp4:A, 6tp4:B, 6tp6:A, 6tp6:B, 6tq4:B, 6tq6:B, 6tq7:A, 6tq7:B, 6tq9:A, 6tq9:B
14	7xrr:A	309	34	0.1505	0.0453	0.4118	0.42	7l1u:R, 7l1v:R, 7sqo:R, 7sr8:R
15	5why:A	418	64	0.2043	0.0455	0.2969	0.65
16	6v9s:A	503	33	0.1505	0.0278	0.4242	0.67	4zj8:A, 4zjc:A
17	6tpn:A	510	31	0.1398	0.0255	0.4194	0.92	4s0v:A, 6tpg:A, 6tpj:A, 6tpj:B, 5wqc:A, 5ws3:A
18	4x28:A	386	45	0.1828	0.0440	0.3778	4.6	4x28:B
19	5i4e:A	959	21	0.1183	0.0115	0.5238	5.3
20	5t04:A	458	19	0.0968	0.0197	0.4737	6.1	4grv:A
21	7l0b:A	202	27	0.1183	0.0545	0.4074	6.7	7l0b:B, 7l0b:C, 7l0b:D
22	5v1d:D	247	64	0.1935	0.0729	0.2812	7.2	5v1d:C
23	3t4k:A	268	54	0.1183	0.0410	0.2037	9.4	3t4j:A, 3t4j:B, 3t4k:B, 3t4l:A, 3t4l:B, 3t4o:A, 3t4o:B, 3t4q:A, 3t4q:B, 3t4s:A, 3t4s:B, 3t4t:A, 3t4t:B

[Back]