YFDLEDIGNTTGQWDLYGSDAPSPYSPLQSKFFETFAAPFTKRGLLLKFLILGGGSTLAYFSTTASGDILPIVKGPQLPP
KL
The query sequence (length=82) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6yez:H | 93 | 82 | 0.9268 | 0.8172 | 0.9268 | 2.71e-50 | 7dkz:H, 5l8r:H, 3lw5:H, 4rku:H, 4y28:H, 6yac:H, 6zoo:H, 6zxs:H |
2 | 4xk8:H | 90 | 82 | 0.8902 | 0.8111 | 0.8902 | 9.79e-49 | 4xk8:h |
3 | 7wfd:AH | 95 | 82 | 0.8293 | 0.7158 | 0.8293 | 2.39e-46 | 8j6z:H, 8j7a:H, 8j7b:H, 2o01:H, 7wfe:BH, 7wg5:AH, 2wsc:H, 2wse:H, 2wsf:H |
4 | 8htu:H | 95 | 80 | 0.6098 | 0.5263 | 0.6250 | 3.79e-33 | 7ksq:H, 7kux:H, 6l35:H, 7xqp:H |
5 | 8wgh:H | 90 | 74 | 0.7561 | 0.6889 | 0.8378 | 9.82e-31 | |
6 | 5zji:H | 95 | 74 | 0.7805 | 0.6737 | 0.8649 | 4.97e-30 | 8bcv:H, 8bcw:H |
7 | 6zzx:H | 94 | 82 | 0.4268 | 0.3723 | 0.4268 | 7.61e-18 | 6zzy:H |
8 | 6sl5:H | 92 | 81 | 0.4146 | 0.3696 | 0.4198 | 4.90e-14 | |
9 | 7d0j:H | 100 | 78 | 0.3780 | 0.3100 | 0.3974 | 5.51e-14 | 7dz7:H, 7dz8:H, 8h2u:H, 6ijo:H |
10 | 6igz:H | 88 | 78 | 0.4024 | 0.3750 | 0.4231 | 1.28e-11 | |
11 | 7yca:H | 96 | 83 | 0.4146 | 0.3542 | 0.4096 | 2.73e-09 | |
12 | 8bo1:B | 398 | 84 | 0.3049 | 0.0628 | 0.2976 | 0.32 | 8bo1:D, 8br0:B, 8br0:D, 8br1:B, 8br1:D |
13 | 5why:A | 418 | 64 | 0.2317 | 0.0455 | 0.2969 | 0.60 | |
14 | 5v1d:A | 193 | 65 | 0.2683 | 0.1140 | 0.3385 | 9.0 |