VTYFSSRKGKRKTVKAVIYRFLRLHSGLWLRRKAGYKKKLWKKTAARKRRLREFVFCNKTQSKLLDKMTTSFWKRRNWYA
The query sequence (length=95) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
7a5f:33 |
95 |
95 |
0.9053 |
0.9053 |
0.9053 |
1.12e-58 |
7a5g:33, 7a5h:3, 7a5i:33, 7a5j:3, 7a5k:33, 5aj4:B8, 8any:3, 4ce4:8, 6gaw:B8, 6gb2:B8, 6i9r:3, 3j7y:3, 3j9m:3, 8k2a:Li, 8k2b:Li, 7l08:3, 7l20:3, 7nqh:B8, 7nql:B8, 7nsh:B8, 7nsi:B8, 7nsj:B8, 6nu2:3, 6nu3:3, 7o9k:3, 7o9m:3, 7odr:3, 7ods:3, 7odt:3, 7of0:3, 7of2:3, 7of3:3, 7of4:3, 7of5:3, 7of6:3, 7of7:3, 7og4:3, 7oi7:3, 7oi8:3, 7oi9:3, 7oia:3, 7oib:3, 7oic:3, 7oid:3, 7oie:3, 8oin:BK, 8oiq:BK, 8oir:BK, 8oit:BK, 5ool:3, 5oom:3, 7pd3:3, 8pk0:3, 7po4:3, 7qh6:3, 7qh7:3, 7qi4:3, 7qi5:3, 7qi6:3, 8qsj:3, 8qu1:3, 8qu5:3, 4v19:8, 6vlz:3, 6vmi:3, 8xt0:Li, 8xt1:Li, 8xt2:Li, 8xt3:Li, 6ydp:B8, 6ydw:B8, 6zm5:3, 6zm6:3, 6zs9:3, 6zsa:3, 6zsb:3, 6zsc:3, 6zsd:3, 6zse:3, 6zsg:3 |
2 |
8cja:A |
669 |
52 |
0.1579 |
0.0224 |
0.2885 |
0.51 |
8cjb:A, 8cjc:A, 8cmw:A, 7zkj:A, 7zkk:A, 7zkv:A |
3 |
6eri:Ad |
72 |
51 |
0.2000 |
0.2639 |
0.3725 |
0.63 |
5h1s:e, 5mlc:5, 5mmi:4, 5mmm:4, 4v61:B5, 5x8p:4, 5x8t:4 |
4 |
8rdj:F |
660 |
27 |
0.1053 |
0.0152 |
0.3704 |
1.0 |
|
5 |
8ras:F |
568 |
27 |
0.1053 |
0.0176 |
0.3704 |
1.5 |
|
6 |
7f0d:3 |
62 |
54 |
0.2105 |
0.3226 |
0.3704 |
2.3 |
7kgb:3, 7msc:3, 7msh:3, 7msm:3, 7msz:3, 7mt2:3, 7mt3:3, 7mt7:3, 7sfr:3, 5v7q:3, 5v93:3 |
7 |
7pcf:F |
341 |
67 |
0.2000 |
0.0557 |
0.2836 |
3.3 |
7pch:E, 7pch:F, 3rtl:A, 3rtl:B, 3rtl:C, 3rtl:D, 3rur:A, 3rur:B, 3rur:C, 3rur:D, 5vmm:F, 5vmm:E |
8 |
6uo8:A |
689 |
56 |
0.1895 |
0.0261 |
0.3214 |
5.0 |
7c7q:A, 7c7s:A, 7ca3:A, 7cum:A, 7eb2:C, 4mqf:A, 4mr7:A, 4mr8:A, 4mr9:A, 4mrm:A, 4ms1:A, 4ms3:A, 4ms4:A, 6uo9:A, 6w2x:A, 6w2y:A, 6w2y:B, 6wiv:A |
9 |
5mq6:A |
636 |
32 |
0.1263 |
0.0189 |
0.3750 |
8.2 |
|
10 |
8tdi:G |
386 |
48 |
0.1474 |
0.0363 |
0.2917 |
9.5 |
8tdi:L, 8tdi:J, 8tdi:A, 8tdi:C, 8tdi:D, 8tdi:E, 8tdi:F, 8tdi:H, 8tdi:I, 8tdi:B, 8tdi:K |