VSTWVCPICMVSNETQGEFTKDTLPTPICINCGVPADYELTKSSINC
The query sequence (length=47) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2j9u:B | 47 | 47 | 1.0000 | 1.0000 | 1.0000 | 1.21e-29 | 2j9u:D |
2 | 7mo3:B | 38 | 16 | 0.1702 | 0.2105 | 0.5000 | 1.5 | 7mo3:D, 7mo4:B, 7mo4:D |
3 | 3a9y:A | 403 | 13 | 0.1277 | 0.0149 | 0.4615 | 1.9 | 3a9x:A, 3a9x:B, 3a9y:B, 3a9z:A, 3a9z:B |
4 | 2y6e:B | 339 | 29 | 0.2553 | 0.0354 | 0.4138 | 1.9 | 2y6e:A, 2y6e:C, 2y6e:E, 2y6e:F |
5 | 5jne:A | 351 | 28 | 0.2128 | 0.0285 | 0.3571 | 3.1 | 3i2d:A, 5jne:E |
6 | 6zga:A | 751 | 19 | 0.1702 | 0.0107 | 0.4211 | 3.1 | 4bzi:A, 4bzi:D, 4bzi:G, 6gni:A, 1m2o:A, 1m2o:C, 2qtv:A, 6zga:E |
7 | 1m2v:A | 705 | 19 | 0.1702 | 0.0113 | 0.4211 | 3.1 | |
8 | 6wq6:A | 547 | 26 | 0.2128 | 0.0183 | 0.3846 | 3.3 | 6wqi:A, 6wqi:B, 6wqs:A, 6wqt:A |
9 | 8e9h:G | 782 | 48 | 0.3830 | 0.0230 | 0.3750 | 3.5 | 8e9g:G, 8e9i:G |
10 | 6bd4:A | 379 | 31 | 0.2340 | 0.0290 | 0.3548 | 6.8 | |
11 | 8q3k:B | 1020 | 20 | 0.1915 | 0.0088 | 0.4500 | 7.5 | |
12 | 8q3b:B | 1104 | 20 | 0.1915 | 0.0082 | 0.4500 | 7.5 | |
13 | 6pk3:B | 400 | 22 | 0.2128 | 0.0250 | 0.4545 | 9.6 | 6pk1:A, 6pk1:B, 6pk3:A |
14 | 8a22:Xe | 483 | 27 | 0.2340 | 0.0228 | 0.4074 | 9.7 | 8apn:Xe, 8apo:Xe |
15 | 2wbt:A | 125 | 35 | 0.2340 | 0.0880 | 0.3143 | 9.9 | 2wbt:B |