VSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKN
RHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7bl5:8 | 157 | 157 | 1.0000 | 1.0000 | 1.0000 | 4.69e-109 | |
2 | 3o26:A | 294 | 42 | 0.1146 | 0.0612 | 0.4286 | 0.71 | |
3 | 2vn0:A | 464 | 59 | 0.1083 | 0.0366 | 0.2881 | 1.6 | 2nnh:A, 2nnh:B, 2nni:A, 2nnj:A, 1pq2:A, 1pq2:B |
4 | 6ca4:C | 229 | 74 | 0.1338 | 0.0917 | 0.2838 | 1.6 | |
5 | 5ee3:B | 364 | 77 | 0.1529 | 0.0659 | 0.3117 | 3.4 | 5ee3:A, 5ee9:A |
6 | 6uke:X | 258 | 65 | 0.1210 | 0.0736 | 0.2923 | 5.1 | 6ukf:X, 6ukg:X, 6ukh:X, 6uki:X, 6uki:Y |
7 | 8sp4:A | 859 | 55 | 0.0955 | 0.0175 | 0.2727 | 7.2 | 8spg:A |
8 | 7xpi:A | 363 | 67 | 0.1146 | 0.0496 | 0.2687 | 8.2 | 7ytl:A |
9 | 3kzl:A | 266 | 73 | 0.1210 | 0.0714 | 0.2603 | 8.7 | 3ijw:A, 3ijw:B, 3kzl:D, 3kzl:C, 3kzl:B, 3n0m:A, 3n0m:B, 3n0s:A, 3n0s:D, 3n0s:C, 3n0s:B, 3slb:A, 3slb:D, 3slb:C, 3slb:B, 3slf:A, 3slf:B |