VQNMMRQKEQEHMINWVEKRVVQSISTIAKCIADLKLLSKK
The query sequence (length=41) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2wss:X | 41 | 41 | 1.0000 | 1.0000 | 1.0000 | 5.62e-24 | |
2 | 6zpo:b | 209 | 47 | 1.0000 | 0.1962 | 0.8723 | 5.45e-21 | 2wss:T, 6z1u:b, 6zbb:b, 6zmr:b, 6zqm:b, 6zqn:b |
3 | 3i5f:A | 810 | 20 | 0.2195 | 0.0111 | 0.4500 | 3.3 | |
4 | 7nac:w | 672 | 23 | 0.2439 | 0.0149 | 0.4348 | 3.4 | 7naf:w, 7r6k:w, 7r7a:w, 7r7o:A, 7r7o:B |
5 | 7u0h:w | 321 | 23 | 0.2439 | 0.0312 | 0.4348 | 3.6 | |
6 | 4tpn:A | 386 | 27 | 0.2439 | 0.0259 | 0.3704 | 3.9 | |
7 | 5d3u:A | 403 | 27 | 0.2439 | 0.0248 | 0.3704 | 3.9 | 5d3u:B, 5d40:A, 5d40:B, 4l36:A, 4l36:B, 4tpo:A |
8 | 2fkc:A | 247 | 31 | 0.2439 | 0.0405 | 0.3226 | 5.0 | 2fkc:B, 2fkh:B, 2fl3:A, 2flc:A |
9 | 6elz:w | 436 | 23 | 0.2439 | 0.0229 | 0.4348 | 5.6 | 6em5:w |
10 | 6ylx:w | 360 | 23 | 0.2439 | 0.0278 | 0.4348 | 6.4 |