BioLiP

>protein
VPTKLEVVAATPTSLLISWDAPAVTVFFYVITYGETGHGVGAFQAFKVPGSKSTATISGLKPGVDYTITVYARGYSKQGP
YKPSPISINYRT

The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7l0f:H	94	92	0.9674	0.9468	0.9674	4.68e-61	7l0f:F, 7l0f:B, 7l0f:M, 7l0g:C, 7l0g:D, 7l0g:F, 7l0g:H
2	5mtm:B	92	92	0.7935	0.7935	0.7935	2.84e-43
3	5v7p:D	95	92	0.8152	0.7895	0.8152	1.07e-41
4	8f0m:B	91	97	0.7935	0.8022	0.7526	1.10e-38
5	4lxo:A	184	92	0.7500	0.3750	0.7500	6.29e-38	4lxo:B
6	4lxo:A	184	79	0.2391	0.1196	0.2785	1.37e-05	4lxo:B
7	5a43:C	96	93	0.7717	0.7396	0.7634	1.36e-37
8	6d0j:C	90	92	0.7065	0.7222	0.7065	1.75e-34	6d0k:C, 6d0n:C
9	6ux8:B	86	92	0.7065	0.7558	0.7065	3.18e-34
10	3ch8:A	190	92	0.7283	0.3526	0.7283	1.04e-31	2qbw:A
11	8vxu:E	90	94	0.7283	0.7444	0.7128	4.72e-30	7szt:F, 8tgy:C, 8tgy:D, 6wk9:C, 6wk9:G
12	4jmh:A	200	93	0.6848	0.3150	0.6774	1.48e-29	4jmg:A
13	3csb:A	464	94	0.7283	0.1444	0.7128	1.88e-27
14	2mnu:A	93	69	0.2717	0.2688	0.3623	2.46e-04
15	6gvk:A	201	92	0.2500	0.1144	0.2500	0.100	6gvl:A
16	6x39:A	100	77	0.2935	0.2700	0.3506	0.11
17	6tba:7A	292	37	0.1413	0.0445	0.3514	1.4	6tba:7C, 6tba:7B, 6teh:C
18	4ine:A	431	20	0.1087	0.0232	0.5000	4.0	4ine:B
19	1e3d:B	537	50	0.1739	0.0298	0.3200	4.8	1e3d:D
20	1unb:A	288	33	0.1196	0.0382	0.3333	5.7	1e5h:A, 1hjf:A, 2jb8:A, 1rxg:A, 1uo9:A, 1uob:A, 1w2a:X, 1w2n:A, 1w2o:A
21	6bt9:B	626	69	0.2174	0.0319	0.2899	5.9	6bt9:A
22	2zoo:A	438	29	0.1413	0.0297	0.4483	6.0
23	3ddv:B	139	41	0.1413	0.0935	0.3171	8.4	3ddv:D
24	6hiv:DA	1557	14	0.0870	0.0051	0.5714	8.8	6hiw:DA, 7pub:DA

[Back]