VNQVATDRFIQDLERVAQVRSEMSVCLNKLAETINKAELAGDSSSGKLSLERDIEDITIASKNLQQGVFRLLVLGDMKRG
KSTFLNALIGENLLPSTAVLTVLRYGPEKKVTIHFNDGKSPQQLDFQNFKYKYTIDPAEAKKLEQEKKQAFPDVDYAVVE
YPLTLLQKGIEIVDSPGLNDTEARNELSLGYVNNCHAILFVMRASQPCTLGERRYLENYIKGRGLTVFFLVNAWDQVRES
LIDPDDVEELQASENRLRQVFNANLAEYCTVEGQNIYDERVFELSSIQALRRRLKNPQADLDGTGFPKFMDSLNTFLTRE
RAIAELRQVRTLARLACNHTREAVARRIPLLEQDVNELKKRIDSVEPEFNKLTGIRDEFQKEIINTRDTQARTISESFRS
YVLNLGNTFENDFLRYQPELNLFDFLSSGKREAFNAALQKAFEQYITDKSAAWTLTAEKDINAAFKELSRSASQYGASYN
QITDQITEKLTGKDVEDNSPGWAKWAMGLLSLSKGNLAGFALAGAGFDWKNILLNYFTVIGIGGIITAVTGILLGPIGFA
LLGLGVGFLQADQARRELVKTAKKELVKHLPQVAHEQSQVVYNAVKECFDSYEREVSKRINDDIVSRKSELDNLVKQKQT
REINRESEFNRLKNLQEDVIAQLQKIEAAYSNLLAYYSHH
The query sequence (length=680) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2j68:A | 680 | 680 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2w6d:A, 2w6d:B |
| 2 | 5oxf:B | 591 | 207 | 0.0868 | 0.0998 | 0.2850 | 3.12e-12 | |
| 3 | 5oxf:A | 703 | 207 | 0.0868 | 0.0839 | 0.2850 | 3.50e-12 | |
| 4 | 6j72:A | 561 | 179 | 0.0632 | 0.0766 | 0.2402 | 3.80e-06 | |
| 5 | 5oxf:C | 601 | 224 | 0.0809 | 0.0915 | 0.2455 | 4.21e-06 | 5oxf:D |
| 6 | 5ksz:A | 398 | 83 | 0.0412 | 0.0704 | 0.3373 | 0.003 | 5kso:A, 5ksp:A, 5ksp:B, 5ksy:A, 5kty:A, 5ku1:A |
| 7 | 6jfk:A | 428 | 269 | 0.0971 | 0.1542 | 0.2454 | 0.018 | 6jfm:A, 6jfm:B |
| 8 | 7egq:X | 524 | 46 | 0.0265 | 0.0344 | 0.3913 | 0.42 | 5c8s:B, 5c8s:D, 5c8t:B, 5c8t:D, 5c8u:B, 5c8u:D, 7diy:B, 7egq:K, 7eiz:K, 9fw2:B, 9fz4:B, 9fzk:B, 7mc5:A, 7mc6:A, 7n0b:B, 7n0c:B, 7n0d:B, 7n0d:D, 7n0d:F, 7n0d:H, 5nfy:A, 5nfy:B, 5nfy:C, 5nfy:D |
| 9 | 7aml:A | 596 | 95 | 0.0368 | 0.0419 | 0.2632 | 0.68 | 7amk:A, 7amk:B, 7aml:D |
| 10 | 6jjm:A | 452 | 53 | 0.0235 | 0.0354 | 0.3019 | 2.1 | 5b2d:A, 5b2d:B, 6jjm:B, 6jjn:A, 6jjn:B |
| 11 | 9bht:C | 282 | 36 | 0.0235 | 0.0567 | 0.4444 | 2.5 | 9bht:D, 9bhw:A, 9bhw:D |
| 12 | 8eti:b | 391 | 88 | 0.0294 | 0.0512 | 0.2273 | 3.0 | 8esr:b, 8etg:b |
| 13 | 6ifl:G | 273 | 57 | 0.0309 | 0.0769 | 0.3684 | 3.1 | 6ifu:G |
| 14 | 8fl4:SR | 593 | 86 | 0.0382 | 0.0438 | 0.3023 | 3.1 | 8fkr:SR, 8fks:SR |
| 15 | 8ir1:4 | 620 | 86 | 0.0382 | 0.0419 | 0.3023 | 3.3 | 8fkt:SR, 8fku:SR, 8fkv:SR, 8fkw:SR, 8fkx:SR, 8fky:SR, 8fkz:SR, 8fl0:SR, 8fl2:SR, 8fl3:SR, 8fl6:SR, 8fl7:SR, 8fl9:SR, 8fla:SR, 8flb:SR, 8flc:SR, 8fld:SR, 8fle:SR, 8flf:SR, 8idt:4, 8idy:4, 8ie3:4, 8ine:4, 8inf:4, 8ink:4, 8ipd:4, 8ipx:4, 8ipy:4, 8ir3:4, 6lss:4, 6lu8:4 |
| 16 | 8etc:b | 415 | 88 | 0.0294 | 0.0482 | 0.2273 | 3.8 | 8esq:b, 8etj:b |
| 17 | 6uek:D | 585 | 51 | 0.0279 | 0.0325 | 0.3725 | 4.5 | |
| 18 | 6ifn:B | 297 | 57 | 0.0309 | 0.0707 | 0.3684 | 4.8 | 6ifk:B, 6ifr:B, 6ify:B, 6ifz:B, 6ig0:B, 6nud:I, 6nue:I |
| 19 | 2w2l:A | 346 | 28 | 0.0191 | 0.0376 | 0.4643 | 5.4 | 2w2l:B, 2w2l:C, 2w2l:D |
| 20 | 2ol1:C | 125 | 64 | 0.0265 | 0.1440 | 0.2812 | 6.1 | 2oke:A, 2oke:C, 2oke:B, 2ol1:A, 2ol1:B |
| 21 | 8rev:A | 709 | 64 | 0.0250 | 0.0240 | 0.2656 | 7.0 | |
| 22 | 4h1v:A | 358 | 33 | 0.0191 | 0.0363 | 0.3939 | 7.2 | |
| 23 | 6iae:B | 148 | 25 | 0.0206 | 0.0946 | 0.5600 | 8.0 | 6ia7:B |
| 24 | 5wp9:A | 590 | 33 | 0.0191 | 0.0220 | 0.3939 | 8.1 | 8skn:A, 8skn:B, 3w6n:A, 3w6n:B, 3w6o:A, 3w6o:B, 3w6p:A, 3w6p:B, 5wp9:C, 5wp9:E, 5wp9:G, 5wp9:I, 5wp9:K, 5wp9:M, 5wp9:O |
| 25 | 6s5h:A | 175 | 60 | 0.0221 | 0.0857 | 0.2500 | 8.3 | 6hdu:A, 6hdu:B, 6hdu:C, 6hdu:D |
| 26 | 7c3k:B | 389 | 41 | 0.0206 | 0.0360 | 0.3415 | 8.6 | 7c3k:A, 8jqz:A, 8jqz:B |
| 27 | 7vex:A | 412 | 101 | 0.0338 | 0.0558 | 0.2277 | 9.1 | 8h4m:A |
umich.edu