VKVKFKYKGEEKEVDTSKIKKVWRVGKFVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAERE
The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1wvl:A | 80 | 63 | 0.9841 | 0.7750 | 0.9841 | 1.93e-39 | 1azp:A, 1azq:A, 1ca5:A, 1ca6:A, 8cmn:AA, 8q2m:AA, 8qpc:AA, 1wd0:A, 1wd1:A, 1wto:A, 1wtp:A, 1wtp:B, 1wtq:A, 1wtr:A, 1wtv:A, 1wtw:A, 1wtx:A, 1xyi:A |
2 | 5b03:D | 333 | 56 | 0.7778 | 0.1471 | 0.8750 | 9.26e-27 | 5b00:A, 5b00:B, 5b00:C, 5b03:A, 5b03:B, 5b03:C, 5b0k:A, 5b0k:B, 5b0k:C, 5b0k:D, 1bbx:C, 1bbx:D, 1bf4:A, 1bnz:A, 1c8c:A, 5gwv:D, 6j8v:D, 6j8w:D |
3 | 7c1m:A | 67 | 61 | 0.6190 | 0.5821 | 0.6393 | 2.21e-20 | |
4 | 6djv:C | 615 | 61 | 0.3016 | 0.0309 | 0.3115 | 1.8 | 6dju:A, 6dju:B, 6dju:C, 6djv:A, 6djv:B |
5 | 6w6h:C | 636 | 61 | 0.3016 | 0.0299 | 0.3115 | 2.0 | 6w6e:B, 6w6e:C, 6w6g:A, 6w6g:B, 6w6g:C, 6w6h:A, 6w6h:B, 6w6h:F, 6w6i:A, 6w6i:B, 6w6i:C, 6w6j:A, 6w6j:B, 6w6j:C |
6 | 8bsj:SL | 109 | 21 | 0.1746 | 0.1009 | 0.5238 | 3.4 | 8br8:SL, 8brm:SL, 8bsi:SL, 8btd:SL, 8btr:SL, 8fvy:K, 8g4s:K |
7 | 7oq6:A | 399 | 11 | 0.1429 | 0.0226 | 0.8182 | 5.7 | 7oq6:B |
8 | 4qiw:A | 863 | 44 | 0.2540 | 0.0185 | 0.3636 | 6.8 | 4qiw:I |
9 | 7k5k:A | 545 | 55 | 0.2063 | 0.0239 | 0.2364 | 7.1 | 7k5k:B, 7k5k:C, 7k5k:D, 7k5k:E, 7k5k:F, 6wvv:A, 6wvv:B, 6wvv:C, 6wvv:D, 6wvv:E |