VKPWLFLIKPYEGESLSHFLGRFRRANHLSASGLGTLAGIGAIVARWERFHFNPRPSQQELEAIASVVEVDAQRLAQMLP
PAGVGMQHEPIRLCGACYAESPCHRIEWQYKSVWKCDRHQLKILAKCPNCQAPFKMPALWEDGCCHRCRMPFAEMAKLQK
V
The query sequence (length=161) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7svu:X | 165 | 160 | 0.9938 | 0.9697 | 1.0000 | 6.69e-119 | 8bd4:S, 8bd4:R, 8bd4:T, 8bd5:Q, 8ea3:Q, 8ea4:Q, 7oxd:A, 8rdu:C, 8rkt:C |
2 | 5xxb:W | 127 | 58 | 0.0870 | 0.1102 | 0.2414 | 1.1 | |
3 | 3n71:A | 468 | 45 | 0.0745 | 0.0256 | 0.2667 | 1.6 | |
4 | 8j78:I | 651 | 53 | 0.0932 | 0.0230 | 0.2830 | 1.9 | 8j78:C, 8j7d:D, 8j7d:F, 8j7d:I, 8j7d:L, 8jaw:A, 8jaw:C, 8jaw:E, 8jaw:F, 8jaw:H, 8jaw:K, 8k2v:A, 8k2v:B, 8k2v:C, 8k2v:D, 8k2v:E, 8k2v:F |
5 | 7r7j:B | 574 | 73 | 0.1242 | 0.0348 | 0.2740 | 2.4 | 8h5y:B, 8h5y:A, 8h5z:B, 8h5z:A, 6jde:B, 6jde:A, 7r7j:A |
6 | 7u5d:I | 387 | 37 | 0.0807 | 0.0336 | 0.3514 | 2.6 | 7u5e:I |
7 | 1hyu:A | 521 | 68 | 0.0994 | 0.0307 | 0.2353 | 2.9 | 1fl2:A, 4o5q:A, 4o5u:A, 4xvg:A, 4ykf:A, 4ykg:A |
8 | 6dwn:D | 453 | 56 | 0.1180 | 0.0419 | 0.3393 | 4.1 | |
9 | 4i8v:A | 477 | 56 | 0.1180 | 0.0398 | 0.3393 | 4.4 | 6dwm:A, 6dwm:B, 6dwm:C, 6dwm:D, 6dwn:A, 6dwn:B, 6dwn:C, 4i8v:B, 4i8v:C, 4i8v:D, 6o5y:A, 6o5y:B, 6o5y:C, 6o5y:D, 6udl:A, 6udl:B, 6udl:C, 6udl:D, 6udm:A, 6udm:B, 6udm:C, 6udm:D |
10 | 8fcu:P | 327 | 44 | 0.0870 | 0.0428 | 0.3182 | 4.9 | 8fcv:P, 8ff4:P |
11 | 4yzr:A | 388 | 32 | 0.0683 | 0.0284 | 0.3438 | 6.4 | |
12 | 2hi4:A | 480 | 56 | 0.1118 | 0.0375 | 0.3214 | 9.1 |