BioLiP

>protein
VKPQESQLSFTATPGSNPNVVTLKNTSSLKGLVVTWDLGNGVTAKGEEVVASYPFANTYTIAMTAYNTGGSTTITQTITI
ANNDESQIEPKAIILAGGLTGSKTWVFDRAHDGHFGVGPGAGNPDYNGTPSWWSCPAEGKAECALYENEFSFHLDGGYNM
TWVNKGKIYTNGAGKDKLPGVATVPGAGDFDVEYIPKEAYTFTVDGDKLKLSDDAFFGHFAGTSTYTIKTLNENELYLEC
SSAVESGNGWWYRFVPKK

The query sequence (length=258) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7kv7:BBB	258	258	1.0000	1.0000	1.0000	0.0	7kv6:AAA, 7kv7:AAA
2	4aqo:A	86	62	0.0814	0.2442	0.3387	0.007
3	5eb8:A	354	41	0.0543	0.0395	0.3415	1.2	5eb8:B, 5eba:A, 5efd:A, 5efd:B, 5eff:A, 5eff:B, 2f8q:A, 2f8q:B, 2fgl:A, 2fgl:B, 4qce:A, 4qce:B, 4qcf:A, 4qdm:A, 4qdm:B, 5xc0:A, 5xc0:B, 5xc1:A, 5xc1:B
4	7w3u:A	343	105	0.1085	0.0816	0.2667	1.4	7w3r:A, 7w3u:B, 7w3u:C
5	4l9d:B	81	65	0.0814	0.2593	0.3231	1.7
6	2aek:A	354	34	0.0465	0.0339	0.3529	2.1	2aek:B, 2ael:B, 2aet:B, 1jfg:B, 1kiz:B, 2ps4:A, 2ps4:B, 2ps5:B, 2ps7:A, 2ps7:B, 2ps8:B, 2q9y:B, 2q9z:B, 1yyq:B, 1yyr:A, 1yyr:B, 1yys:A, 1yys:B, 1yyt:A, 1yyt:B, 1yyu:A, 1yyu:B
7	4u7k:A	86	49	0.0543	0.1628	0.2857	3.2	4u7k:B, 4u7k:C, 4u7k:D, 4u7k:E, 4u7k:F, 4u7k:G, 4u7k:H
8	5z6o:A	282	65	0.0698	0.0638	0.2769	3.8
9	8k2m:A	559	50	0.0620	0.0286	0.3200	6.7
10	3zhm:A	79	63	0.0620	0.2025	0.2540	8.4
11	8bh8:A	523	27	0.0426	0.0210	0.4074	9.2	8bh9:A
12	1iay:A	419	47	0.0543	0.0334	0.2979	9.7	1iax:A, 1iax:B

[Back]