BioLiP

>protein
VIAMPSVRKYAREKGVDIGTGKNGRVLKEDIDAF

The query sequence (length=34) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1w85:J	34	34	1.0000	1.0000	1.0000	5.81e-19
2	8oqj:B	55	38	0.5294	0.3273	0.4737	2.48e-06
3	6s6b:J	475	23	0.3235	0.0232	0.4783	2.3	6s8b:J, 6s8e:J, 6s91:J, 6sh8:J, 6shb:J, 6sic:J
4	5csu:A	518	12	0.2647	0.0174	0.7500	2.4	5cps:A, 5cps:B, 5cpt:A, 5cpt:B, 5cq1:A, 5cq1:B, 5csu:B, 5csy:A, 5csy:B
5	7k78:E	98	33	0.3235	0.1122	0.3333	2.5	7on1:e, 7on1:a, 8ow0:e, 8ow0:a, 8ow1:e, 8ow1:a, 6uph:E
6	8t4j:A	552	13	0.2353	0.0145	0.6154	3.7	1jj7:A, 8t4e:A, 8t4f:A, 8t4g:A, 8t4h:A, 8t4i:A
7	3myu:B	334	26	0.2647	0.0269	0.3462	4.5	3myu:A
8	5l2v:A	166	20	0.2353	0.0482	0.4000	5.1	5l2v:B
9	4zda:A	735	29	0.3235	0.0150	0.3793	5.4	4zda:B, 4zda:C, 4zda:D, 4zda:E, 4zda:F
10	1of6:A	350	19	0.2941	0.0286	0.5263	6.7	1hfb:A, 1hfb:B, 1hfb:C, 1hfb:D, 1hfb:E, 1hfb:F, 1hfb:G, 1hfb:H, 1oab:A, 1oab:B, 1of6:B, 1of6:C, 1of6:D, 1of6:E, 1of6:F, 1of6:G, 1of6:H, 1of8:A, 1of8:B, 1ofa:B, 1ofa:A, 1ofb:A, 1ofb:B, 1ofo:A, 1ofo:B, 1ofq:A, 1ofq:B, 1ofq:C, 1ofq:D, 1ofr:A, 1ofr:H, 1ofr:C, 1ofr:D, 1ofr:E, 1ofr:F, 1ofr:G, 1ofr:B, 1og0:A, 1og0:B, 1og0:C, 1og0:D, 1og0:E, 1og0:F, 1og0:G, 1og0:H
11	7o84:A	410	22	0.2647	0.0220	0.4091	7.0	7o84:B
12	2eco:A	302	24	0.2941	0.0331	0.4167	7.2	2ecq:A, 2efy:A, 2efy:B, 1ve1:A
13	1z41:A	337	26	0.2647	0.0267	0.3462	7.8	1z41:B, 1z42:A, 1z42:B, 1z44:A, 1z44:B, 1z48:A, 1z48:B
14	4jro:C	247	32	0.3235	0.0445	0.3438	9.5	4jro:B, 4jro:D

[Back]