VGYTPVNPDTSPMLAYSQYHWHYNLPQGMERPHGVNRTMTAPYQSAHSLVNKYRGVWIELDMHPAFRVALEPQLRKLPQG
The query sequence (length=315) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
7aor:aj |
315 |
315 |
1.0000 |
1.0000 |
1.0000 |
0.0 |
|
2 |
7pub:DJ |
357 |
315 |
0.8000 |
0.7059 |
0.8000 |
0.0 |
6hiv:DJ, 6hiw:DJ, 6hiz:DJ, 7pua:DJ, 6sg9:DJ, 6sgb:DJ |
3 |
7ane:aj |
316 |
316 |
0.7111 |
0.7089 |
0.7089 |
1.14e-172 |
|
4 |
6q2m:A |
544 |
68 |
0.0667 |
0.0386 |
0.3088 |
0.24 |
1ba3:A, 5dwv:A, 4e5d:A, 4g36:A, 4g36:B, 4g37:A, 4g37:B, 5gyz:A, 5gz2:A, 6hps:A, 6hps:B, 3ies:A, 5kyt:A, 5kyt:B, 5kyv:A, 5kyv:B, 6q2m:B, 6q2m:C, 3rix:A, 5wys:A |
5 |
7c5o:O |
338 |
59 |
0.0571 |
0.0533 |
0.3051 |
0.88 |
7c5f:O, 7c5f:P, 7c5f:Q, 7c5f:R, 7c5g:O, 7c5g:P, 7c5g:Q, 7c5g:R, 7c5h:O, 7c5h:P, 7c5h:Q, 7c5h:R, 7c5i:O, 7c5i:P, 7c5i:Q, 7c5i:R, 7c5j:O, 7c5j:P, 7c5j:Q, 7c5j:R, 7c5k:O, 7c5k:P, 7c5k:Q, 7c5k:R, 7c5l:O, 7c5l:P, 7c5l:Q, 7c5l:R, 7c5m:O, 7c5m:P, 7c5m:Q, 7c5m:R, 7c5n:O, 7c5n:P, 7c5n:Q, 7c5n:R, 7c5o:P, 7c5o:Q, 7c5o:R, 7c5p:O, 7c5p:P, 7c5p:Q, 7c5p:R, 7c5q:O, 7c5q:P, 7c5q:Q, 7c5q:R, 7c5r:O, 7c5r:P, 7c5r:Q, 7c5r:R, 7c7k:O, 7c7k:P, 7c7k:Q, 7c7k:R |
6 |
8cg6:A |
1208 |
42 |
0.0476 |
0.0124 |
0.3571 |
0.91 |
|
7 |
6bt2:B |
271 |
38 |
0.0476 |
0.0554 |
0.3947 |
1.2 |
|
8 |
6y1x:A |
252 |
36 |
0.0540 |
0.0675 |
0.4722 |
3.1 |
6y1x:B |
9 |
2j0d:B |
445 |
61 |
0.0540 |
0.0382 |
0.2787 |
3.6 |
9bbb:A, 6bdh:A, 6dab:A, 8ewd:A, 8ewm:A, 8ewn:A, 8exb:A, 7ksa:A, 7kvh:B, 7kvs:B, 7uay:A, 7uaz:A, 7uf9:A, 6uni:A, 6unj:A, 6unj:B, 6unl:A, 6unm:A, 6unm:B |
10 |
4ccw:A |
285 |
51 |
0.0571 |
0.0632 |
0.3529 |
5.2 |
|
11 |
4q86:B |
583 |
48 |
0.0571 |
0.0309 |
0.3750 |
6.2 |
4q85:A, 4q85:B, 4q85:C, 4q85:D, 4q85:E, 4q85:G, 4q85:H, 4q86:A, 4q86:C, 4q86:D, 4q86:E, 4q86:G, 4q86:H |
12 |
7q54:C |
368 |
75 |
0.0730 |
0.0625 |
0.3067 |
9.0 |
2pkq:O, 2pkq:Q, 2pkq:T, 7q53:O, 7q53:Q, 7q54:Q, 7q54:O, 7q54:A, 7q55:O, 7q55:Q, 7q55:A, 7q55:C, 7q55:E, 7q55:G, 7q55:I, 7q55:K, 7q56:K, 7q56:E, 7q56:I, 7q56:A, 7q56:G, 7q56:C, 7q56:Q, 7q56:O, 7q57:O, 7q57:Q, 7q57:A, 7q57:C, 7q57:G, 7q57:E, 7q57:I, 7q57:K, 7q57:M, 7q57:S |
13 |
3j92:z |
130 |
81 |
0.0603 |
0.1462 |
0.2346 |
9.4 |
|