VEVIFYLSDREPLRLGSGEYTAEELCIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVMSLRLHYRMRFYFTNWHG
The query sequence (length=420) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
5ixi:A |
436 |
444 |
0.9810 |
0.9450 |
0.9279 |
0.0 |
5ixd:A |
2 |
8ewy:A |
1049 |
468 |
0.9452 |
0.3785 |
0.8483 |
0.0 |
6aah:A, 6aah:B, 6bbu:A, 6c7y:A, 6dbn:A, 5e1e:A, 5e1e:B, 4e4l:A, 4e4l:E, 4e4l:B, 4e4l:D, 4e4n:A, 4e4n:B, 4e5w:A, 4e5w:B, 4ehz:A, 4ehz:B, 4ehz:C, 4ehz:D, 4ei4:A, 4ei4:B, 6elr:A, 6elr:B, 8ewy:B, 3eyg:A, 3eyh:A, 4fk6:A, 4fk6:B, 6ggh:A, 6ggh:B, 5hx8:A, 5hx8:B, 6hzu:A, 6hzu:B, 4i5c:A, 4i5c:B, 4ivb:A, 4ivb:B, 4ivc:A, 4ivc:B, 4ivd:A, 4ivd:B, 4k6z:A, 4k77:A, 4k77:B, 5khw:A, 5khw:B, 5khx:A, 6n77:A, 6n77:B, 6n78:A, 6n79:A, 6n7a:A, 6n7a:B, 6n7b:A, 6n7c:A, 6n7c:B, 6n7d:A, 6rsb:A, 6rsb:B, 6rsc:A, 6rsc:B, 6rsd:A, 6rsd:B, 6rse:A, 6rse:B, 6rsh:A, 6rsh:B, 6sm8:A, 6sm8:B, 6smb:A, 6smb:B, 7t6f:A, 7t6f:B, 6tpe:A, 6tpe:B, 6tpf:A, 6tpf:B, 6w8l:A, 5wo4:A, 5wo4:B |
3 |
4po6:A |
475 |
453 |
0.4333 |
0.3832 |
0.4018 |
9.65e-98 |
|
4 |
6e2p:A |
457 |
469 |
0.4286 |
0.3939 |
0.3838 |
1.55e-86 |
6e2p:B |
5 |
8c6j:o |
513 |
64 |
0.0429 |
0.0351 |
0.2812 |
0.70 |
7a5p:E, 6ff4:E, 9fmd:W, 6icz:W, 6id0:W, 6id1:W, 5mqf:E, 6qdv:o, 8ro2:W, 7w59:W, 7w5a:W, 7w5b:W, 5xjc:W, 6zym:E |
6 |
8i0w:W |
440 |
64 |
0.0429 |
0.0409 |
0.2812 |
0.88 |
5yzg:W |
7 |
5ech:A |
569 |
177 |
0.0881 |
0.0650 |
0.2090 |
2.4 |
5ech:D, 5eci:A, 5eci:D, 5eck:A, 5eck:D, 5ecl:A, 5ecl:D, 5ecm:A, 5ecm:D, 5ecn:A, 5ecn:D, 5eco:A, 5eco:D, 5ecp:A, 5ecp:D, 5ecq:A, 5ecq:D, 5ecr:A, 5ecr:D, 4epl:A, 5gzz:A |
8 |
3ei9:A |
412 |
43 |
0.0381 |
0.0388 |
0.3721 |
5.3 |
3ei5:A, 3ei5:B, 3ei6:A, 3ei6:B, 3ei8:A, 3ei8:B, 3ei9:B, 3eia:A, 3eia:B, 3eib:A, 3eib:B, 2z1z:A, 2z1z:B, 2z20:A, 2z20:B |
9 |
5hdp:D |
316 |
33 |
0.0333 |
0.0443 |
0.4242 |
9.0 |
5hdp:A, 5hdp:B, 5hdp:C, 5hdp:E, 5hdp:F, 5hdp:G |
10 |
7knv:A |
126 |
63 |
0.0405 |
0.1349 |
0.2698 |
10.0 |
6ppo:U |