BioLiP

>protein
VETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERI
VYFKNKEHCYASVRNVKK

The query sequence (length=98) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3bs1:A	103	98	1.0000	0.9515	1.0000	1.29e-68	4xqj:A, 4xqj:D, 4xqn:A, 4xqn:J, 4xqn:D, 4xqn:G, 4xqq:B, 4xxe:A, 4xxe:D, 4xyq:A
2	4coy:A	232	42	0.1735	0.0733	0.4048	0.66	4cou:A, 4cov:A, 4cow:A, 4coz:A
3	5a7v:A	368	41	0.1327	0.0353	0.3171	0.94	5a7v:B
4	4f03:A	251	38	0.1224	0.0478	0.3158	0.95	4f03:B, 4f03:C, 4g19:A, 4g19:B, 4g19:C, 4g19:D
5	6e60:A	538	28	0.0918	0.0167	0.3214	3.3	6dmf:A, 6dmf:B, 6dmf:C, 6dmf:D, 6dmf:E, 6dmf:F, 6dmf:G, 6dmf:H, 6dmf:I, 6dmf:J, 6e61:A, 6e61:B, 7nox:A, 7nox:B
6	5csl:B	2072	22	0.1122	0.0053	0.5000	4.3	5ctb:A, 5ctb:C, 5ctc:A, 5ctc:B, 5ctc:C, 5cte:B, 5cte:C, 3h0s:A, 3k8x:A, 3k8x:B, 3k8x:C, 1od2:A, 1od2:B, 3pgq:A, 3pgq:C, 3tv5:A, 3tv5:B, 3tv5:C, 3tvu:A, 3tvu:B, 3tvu:C, 3tvw:A, 3tvw:B, 3tvw:C, 3tz3:A, 3tz3:B, 3tz3:C, 1w96:A, 1w96:B, 1w96:C, 4wyo:B, 4wyo:C, 4wz8:B, 4wz8:C
7	5csl:A	2050	22	0.1122	0.0054	0.5000	4.5
8	7auk:A	168	65	0.2041	0.1190	0.3077	4.9	7aui:A, 7auj:A, 7aul:A, 7aum:A, 7aun:A, 7aup:A, 7aus:A
9	6d4g:B	187	31	0.1020	0.0535	0.3226	6.3
10	7eqh:A	212	18	0.1122	0.0519	0.6111	9.4	7eqh:B

[Back]