BioLiP

>protein
VCPYLEETFKILGRSWNGLIINYLSRSNDSSAHFSDMKRDLKTITPRALSLKLSELAQWELVEKQIISTSPVQIIYVLTE
KGKALAEALHPIEAWAQSY

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4hqe:B	108	99	0.9798	0.8981	0.9798	8.90e-69	4hqe:A, 4hqm:A, 4hqm:B
2	2bcg:G	442	26	0.1414	0.0317	0.5385	0.11	1ukv:G
3	8t4m:D	533	67	0.2222	0.0413	0.3284	0.21	9bc6:D, 9bc6:A, 9bc6:B, 9bc6:C, 9bc7:A, 9bc7:B, 9bc7:C, 9bc7:D, 3bpz:A, 3bpz:B, 3bpz:C, 3bpz:D, 5khg:A, 5khh:A, 5khi:A, 5khj:A, 5khj:B, 5khk:A, 2q0a:A, 2q0a:B, 1q3e:A, 1q3e:B, 1q43:A, 1q43:B, 1q5o:A, 8t4m:C, 8t4m:B, 8t4m:A, 8t4y:A, 8t4y:D, 8t4y:C, 8t4y:B, 3u0z:A, 3u0z:B, 3u10:A, 5u6p:A, 5u6p:B, 5u6p:C, 5u6p:D, 8uc7:D, 8uc7:A, 8uc7:B, 8uc7:C, 6uqf:A, 6uqf:B, 6uqf:C, 6uqf:D, 6uqg:A, 6uqg:B, 6uqg:C, 6uqg:D
4	8t50:C	474	35	0.1414	0.0295	0.4000	0.22	8t50:B, 8t50:A, 8t50:D
5	2f2e:B	140	102	0.2525	0.1786	0.2451	0.42
6	4krc:A	297	29	0.1111	0.0370	0.3793	0.45	2pmi:A
7	4xrf:A	142	44	0.1515	0.1056	0.3409	3.1
8	7ou2:A	721	90	0.2525	0.0347	0.2778	3.1	5akb:E, 7oto:B, 7oto:A, 7ou0:B, 7ou0:A, 7ou4:A, 7ou4:B
9	3asz:B	208	37	0.1313	0.0625	0.3514	4.8	3asz:A, 3w34:A, 3w34:B, 3w8r:A, 3w8r:B
10	4i2w:A	904	58	0.1717	0.0188	0.2931	7.0	4i2z:A
11	8iew:A	498	67	0.1919	0.0382	0.2836	9.2	8inb:A

[Back]