VALSFHDLHQLTRAAVERAQQLQVPVVVSIVDAHGTETVTWRMPDALLVSSELAPKKAWTAVAMKTATHELSDVVQPGAA
LYGLESHLQGKVVTFGGGYALWRDGILIGGLGISGGSVEQDMDIAQTAIAAINVGTHQ
The query sequence (length=138) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5cx7:E | 139 | 138 | 1.0000 | 0.9928 | 1.0000 | 2.65e-97 | 5cx7:A, 5cx7:B, 5cx7:C, 5cx7:D, 5cx7:F, 5cx7:G, 5cx7:H, 5cx7:I, 5cx7:J, 5cx7:K, 5cx7:L, 5cx7:M, 5cx7:N, 5cx7:O, 5cx7:P |
2 | 6c0z:A | 137 | 121 | 0.3333 | 0.3358 | 0.3802 | 1.80e-15 | 6c0z:C, 6c0z:D |
3 | 3fpv:A | 141 | 98 | 0.2174 | 0.2128 | 0.3061 | 0.004 | 3fpv:B, 3fpv:C, 3fpv:D, 3fpv:E, 3fpv:G, 3fpv:F, 3fpv:H |
4 | 3lpp:B | 869 | 56 | 0.1087 | 0.0173 | 0.2679 | 0.50 | 3lpp:D |
5 | 8gm4:A | 462 | 43 | 0.1014 | 0.0303 | 0.3256 | 1.4 | |
6 | 8fny:A | 497 | 41 | 0.0942 | 0.0262 | 0.3171 | 4.6 | 8fny:C, 8fo6:A, 8gm5:A, 7shq:A |
7 | 6w3o:B | 252 | 72 | 0.1594 | 0.0873 | 0.3056 | 6.1 | 6w3o:A, 6w3p:A, 6w3p:B, 6w3r:A, 6w3r:B, 6w3s:A, 6w3s:B, 6w3t:A, 6w3t:B, 6w3v:A, 6w3v:B, 6w3x:A, 6w3x:B, 6w3y:A, 6w3y:B, 4xmr:A, 4xmr:B |
8 | 1lbg:A | 357 | 36 | 0.1087 | 0.0420 | 0.4167 | 7.2 | 2bjc:A, 2bjc:B, 1cjg:A, 1cjg:B, 1efa:A, 1efa:B, 1efa:C, 1jwl:B, 1jwl:A, 1jwl:C, 2kei:A, 2kei:B, 2kej:A, 2kej:B, 2kek:A, 2kek:B, 1l1m:A, 1l1m:B, 1lbg:D, 1lbh:A, 1lbh:B, 1lbh:C, 1lbh:D, 1lcc:A, 1lcd:A, 1osl:A, 1osl:B, 2p9h:A, 2p9h:B, 2paf:A, 2paf:B, 2pe5:A, 2pe5:B, 2pe5:C, 4rzt:A, 4rzt:B, 4rzt:C, 4rzt:D, 1tlf:A, 1tlf:B, 1tlf:C, 1tlf:D |
9 | 6z7p:A | 1025 | 50 | 0.1232 | 0.0166 | 0.3400 | 8.3 | 8bqe:B, 8bqe:C, 8bqe:E, 8bqe:D, 8bqe:F, 8bqe:A, 5n8p:A, 5n8p:B, 5n8p:C, 5n8p:D, 5n8p:E, 5n8p:F, 5n97:A, 5n97:B, 5n97:C, 5n97:D, 5n97:E, 5n97:F, 7peo:A, 6t72:A |
10 | 4pyt:A | 302 | 42 | 0.1232 | 0.0563 | 0.4048 | 9.4 |