VAARGGELTQSTHLTLEAATKAARAAVEAAEKDGRHVSVAVVDRNGNTLVTLRGDGAGPQSYESAERKAFTAVSWNAPTS
ELAKRLAQAPTLKDIPGTLFLAGGTPVTAKGAPVAGIGVAGAPSGDLDEQYARAGAAVLGH
The query sequence (length=141) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 3fpv:A | 141 | 141 | 1.0000 | 1.0000 | 1.0000 | 1.31e-97 | 3fpv:B, 3fpv:C, 3fpv:D, 3fpv:E, 3fpv:G, 3fpv:F, 3fpv:H |
| 2 | 6c0z:A | 137 | 134 | 0.3262 | 0.3358 | 0.3433 | 3.02e-10 | 6c0z:C, 6c0z:D |
| 3 | 5cx7:E | 139 | 70 | 0.1915 | 0.1942 | 0.3857 | 2.56e-04 | 5cx7:A, 5cx7:B, 5cx7:C, 5cx7:D, 5cx7:F, 5cx7:G, 5cx7:H, 5cx7:I, 5cx7:J, 5cx7:K, 5cx7:L, 5cx7:M, 5cx7:N, 5cx7:O, 5cx7:P |
| 4 | 5ftx:A | 651 | 27 | 0.0780 | 0.0169 | 0.4074 | 2.0 | 5fty:A, 5fty:B, 4uie:A, 4uj7:A, 4uj8:A, 4uj8:B, 4uj8:C, 4uj8:D |
| 5 | 1p17:B | 204 | 29 | 0.0851 | 0.0588 | 0.4138 | 4.0 | 1i0i:A, 1i0i:B, 1i0l:A, 1i0l:B, 1i13:A, 1i13:B, 1i14:A, 1i14:B, 1p17:A, 1p17:C, 1p17:D, 1p18:A, 1p18:B, 1p19:A, 1p19:B, 1p19:C, 1p19:D, 1tc1:A, 1tc1:B, 1tc2:A, 1tc2:B |
| 6 | 6nun:A | 516 | 49 | 0.1135 | 0.0310 | 0.3265 | 4.1 | |
| 7 | 7sbb:I | 680 | 34 | 0.0851 | 0.0176 | 0.3529 | 4.1 | |
| 8 | 5t99:A | 757 | 68 | 0.1348 | 0.0251 | 0.2794 | 5.0 | 5t99:B |
| 9 | 3r7k:A | 378 | 43 | 0.0851 | 0.0317 | 0.2791 | 5.0 | 3r7k:B, 3r7k:C, 3r7k:D |
| 10 | 7me2:A | 281 | 27 | 0.0709 | 0.0356 | 0.3704 | 6.9 | 7me1:A, 7me1:B, 7me2:B, 7me3:A, 7me3:B, 6q1d:A, 5uxs:A, 5uxu:A, 5uy0:A, 5uy4:A, 5uy5:A, 5uya:A, 5uyb:A, 5uyc:A, 5uyd:A, 5uye:A, 5uyf:A, 5uyg:A, 5uyh:A, 5uyv:A, 5uyw:A |
| 11 | 5swi:B | 693 | 35 | 0.0922 | 0.0188 | 0.3714 | 9.4 | 5swi:A, 5swi:C, 5swi:D |
umich.edu