TVQWLLDNYETAEGVSLPRSTLYNHYLLHSQEQKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGLRIKA
The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1dp7:P | 76 | 76 | 1.0000 | 1.0000 | 1.0000 | 1.12e-52 | |
2 | 4e4f:B | 381 | 25 | 0.1447 | 0.0289 | 0.4400 | 0.049 | 4e4f:C, 4il2:A, 4il2:C, 4il2:D |
3 | 4il2:B | 404 | 30 | 0.1579 | 0.0297 | 0.4000 | 0.10 | 4e4f:A, 4e4f:D |
4 | 6aqz:A | 334 | 12 | 0.1316 | 0.0299 | 0.8333 | 0.54 | 6aqz:B, 6aqz:C, 6aqz:E, 6aqz:F |
5 | 3av4:A | 1140 | 50 | 0.1711 | 0.0114 | 0.2600 | 0.73 | 3av5:A, 3av6:A, 4da4:B, 5gut:A, 5guv:A, 3pt9:A, 6w8v:B, 6w8w:A, 6w8w:B, 5wy1:A |
6 | 2xzl:A | 756 | 18 | 0.1316 | 0.0132 | 0.5556 | 4.2 | |
7 | 9fvt:A | 519 | 22 | 0.1184 | 0.0173 | 0.4091 | 8.1 | 9fvt:B, 9fvt:C, 9fvt:D |
8 | 6yw5:RR | 134 | 20 | 0.1184 | 0.0672 | 0.4500 | 8.1 | 6ywe:RR, 6ywx:RR, 6ywy:RR |