BioLiP

>protein
TSSHTVLLIQTSPRLDSRTWGDYESVTDALDALCKMFEDFLSKKSAAPVTYDVSQVYEFLDKLSDVSMMIFNRETGQYIG
RTRAWIKQQVYEMMRGR

The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7o6n:B	97	97	1.0000	1.0000	1.0000	5.88e-70	7o6n:A
2	3uva:C	405	56	0.1649	0.0395	0.2857	0.30	3uu0:A, 3uu0:B, 3uu0:C, 3uu0:D, 3uva:A, 3uva:B, 3uva:D, 3uxi:A
3	6zu5:SH0	156	38	0.1443	0.0897	0.3684	2.0
4	5kp7:A	410	70	0.1856	0.0439	0.2571	5.2	5kp8:A
5	5nrg:D	137	23	0.1237	0.0876	0.5217	6.5
6	6zdu:A	693	67	0.1649	0.0231	0.2388	7.5	6zdq:A, 6zdu:B
7	5fqg:A	583	55	0.1340	0.0223	0.2364	7.9	5fqh:A, 5fr0:A
8	8p2f:J	176	23	0.1237	0.0682	0.5217	8.0	7asm:F, 7aso:K, 7asp:F, 6fxc:AF, 6fxc:BF, 5hkv:D, 5hl7:D, 6hma:F, 5li0:G, 5nd8:G, 5nd9:G, 5ngm:AF, 7nhl:J, 7nhm:J, 8p2g:J, 8p2h:J, 7p48:F, 6s0x:F, 6s0z:F, 6s12:F, 6s13:F, 5tcu:LK, 4wce:D, 4wf9:D, 4wfa:D, 8y36:F, 8y37:F, 8y38:F, 8y39:F, 6yef:G
9	4wfb:D	139	26	0.1340	0.0935	0.5000	9.0
10	7r04:A	2326	28	0.0928	0.0039	0.3214	9.2
11	7pgr:N	2423	28	0.0928	0.0037	0.3214	9.2	2d4q:A, 2d4q:B, 2e2x:B, 3p7z:B, 3pg7:B, 7pgq:F, 7pgr:F, 7pgs:F, 7pgt:F, 7pgu:F, 7pgu:N
12	6o8w:F	177	23	0.1237	0.0678	0.5217	9.4	7nhk:J, 6o8x:F, 6o8y:F, 6o8z:F, 6o90:F, 7p7q:J, 7p7r:J, 7p7s:J, 7p7t:J, 7p7u:J, 6w6p:F, 6wu9:F
13	3vol:A	138	34	0.1031	0.0725	0.2941	9.9	4hi4:A, 4hi4:B, 4hi4:D, 4hi4:G

[Back]