TSSHTVLLIQTSPRLDSRTWGDYESVTDALDALCKMFEDFLSKKSAAPVTYDVSQVYEFLDKLSDVSMMIFNRETGQYIG
RTRAWIKQQVYEMMR
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7o6n:B | 97 | 95 | 1.0000 | 0.9794 | 1.0000 | 3.22e-68 | 7o6n:A |
2 | 3uva:C | 405 | 56 | 0.1684 | 0.0395 | 0.2857 | 0.31 | 3uu0:A, 3uu0:B, 3uu0:C, 3uu0:D, 3uva:A, 3uva:B, 3uva:D, 3uxi:A |
3 | 6zu5:SH0 | 156 | 38 | 0.1474 | 0.0897 | 0.3684 | 1.9 | |
4 | 5nrg:D | 137 | 23 | 0.1263 | 0.0876 | 0.5217 | 5.4 | |
5 | 5kp7:A | 410 | 70 | 0.1895 | 0.0439 | 0.2571 | 5.8 | 5kp8:A |
6 | 8p2f:J | 176 | 23 | 0.1263 | 0.0682 | 0.5217 | 6.4 | 7asm:F, 7aso:K, 7asp:F, 6fxc:AF, 6fxc:BF, 5hkv:D, 5hl7:D, 6hma:F, 5li0:G, 5nd8:G, 5nd9:G, 5ngm:AF, 7nhl:J, 7nhm:J, 8p2g:J, 8p2h:J, 7p48:F, 6s0x:F, 6s0z:F, 6s12:F, 6s13:F, 5tcu:LK, 4wce:D, 4wf9:D, 4wfa:D, 8y36:F, 8y37:F, 8y38:F, 8y39:F, 6yef:G |
7 | 4wfb:D | 139 | 26 | 0.1368 | 0.0935 | 0.5000 | 6.9 | |
8 | 6zdu:A | 693 | 49 | 0.1368 | 0.0188 | 0.2653 | 7.6 | 6zdq:A, 6zdu:B |
9 | 6o8w:F | 177 | 23 | 0.1263 | 0.0678 | 0.5217 | 7.8 | 7nhk:J, 6o8x:F, 6o8y:F, 6o8z:F, 6o90:F, 7p7q:J, 7p7r:J, 7p7s:J, 7p7t:J, 7p7u:J, 6w6p:F, 6wu9:F |
10 | 5fqg:A | 583 | 55 | 0.1368 | 0.0223 | 0.2364 | 8.8 | 5fqh:A, 5fr0:A |
11 | 7z87:A | 3689 | 23 | 0.0842 | 0.0022 | 0.3478 | 9.6 | |
12 | 7k17:B | 3645 | 23 | 0.0842 | 0.0022 | 0.3478 | 9.7 | 7k17:A |
13 | 7pgr:N | 2423 | 28 | 0.0947 | 0.0037 | 0.3214 | 9.7 | 2d4q:A, 2d4q:B, 2e2x:B, 3p7z:B, 3pg7:B, 7pgq:F, 7pgr:F, 7pgs:F, 7pgt:F, 7pgu:F, 7pgu:N |
14 | 8ez9:L | 3662 | 23 | 0.0842 | 0.0022 | 0.3478 | 9.8 | 8ez9:C |
15 | 7k1j:A | 3584 | 23 | 0.0842 | 0.0022 | 0.3478 | 9.9 | 7k19:A |
16 | 7k0y:A | 3669 | 23 | 0.0842 | 0.0022 | 0.3478 | 9.9 | |
17 | 6zha:A | 3707 | 23 | 0.0842 | 0.0022 | 0.3478 | 9.9 | 6zh8:A |
18 | 8eza:L | 3720 | 23 | 0.0842 | 0.0022 | 0.3478 | 9.9 | 8eza:C, 7lt3:C, 7lt3:L |
19 | 8ezb:C | 3724 | 23 | 0.0842 | 0.0021 | 0.3478 | 9.9 | 8ezb:L |
20 | 6zhe:A | 3768 | 23 | 0.0842 | 0.0021 | 0.3478 | 9.9 | |
21 | 7r04:A | 2326 | 28 | 0.0947 | 0.0039 | 0.3214 | 9.9 | |
22 | 7nfc:A | 3562 | 23 | 0.0842 | 0.0022 | 0.3478 | 10.0 | 8bh3:S, 8bh3:A, 8bhv:A, 8bhv:F, 8bhy:A, 8bhy:S, 8bot:F, 8bot:S, 7nfc:F |
23 | 7otm:A | 3656 | 23 | 0.0842 | 0.0022 | 0.3478 | 10.0 | 7otp:A, 7otv:A, 7otw:A, 7oty:A |
24 | 6zhe:F | 3731 | 23 | 0.0842 | 0.0021 | 0.3478 | 10.0 |