TSPLLAPVRQIHAFGDAYSDNGESQRLTREMLAKGIAGAQALPGEVYWQGRWSNGPTAVEVLARQLGAQLADHAVGGAKS
GADNYYGWMSAYRHTGLAGQVDAYLATLDGKPVDGQALHFIFVSANDFFEHEDFAGEQPLEQLAGSSVANIRAAVQRLGE
AGARRFLVVSSTDLSVVPAVVAGNRVERAQRYLQAVNASLPIQLAALRKTRGLELSWFDHLTFSRHLRRNPARYGLVELD
APCQPTQPSVRPACANPDQYYFWDEWHPTRRVHQLAGEAMAARYAR
The query sequence (length=286) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8d8x:A | 287 | 286 | 0.9965 | 0.9930 | 0.9965 | 0.0 | 8d8y:A, 8d8y:B, 8d8z:A, 8d8z:B, 6uqw:A, 6uqw:B, 6uqx:A, 6uqx:B, 6uqy:A, 6uqy:B, 6uqz:A, 6uqz:B, 6ur0:A, 6ur0:B, 6ur1:A, 6ur1:B |
2 | 8a25:A | 289 | 294 | 0.2727 | 0.2699 | 0.2653 | 4.26e-17 | 8a26:A |
3 | 8h0d:A | 390 | 294 | 0.2587 | 0.1897 | 0.2517 | 3.70e-12 | 8h09:A, 8h09:B, 8h0a:B, 8h0b:B, 8h0c:A, 8h0c:B, 8h0d:B |
4 | 6jl2:A | 401 | 292 | 0.2448 | 0.1746 | 0.2397 | 1.24e-11 | 6jkz:A, 6jl2:B, 6jl2:C |
5 | 8hwp:A | 328 | 337 | 0.2727 | 0.2378 | 0.2315 | 2.17e-08 | 5xtu:A |
6 | 3kvn:X | 628 | 327 | 0.2937 | 0.1338 | 0.2569 | 1.36e-05 | 3kvn:A |
7 | 7q8b:A | 370 | 61 | 0.0594 | 0.0459 | 0.2787 | 1.3 | 8c47:A, 7q8b:B, 7q8b:C, 7q8b:D, 7q8b:E, 7q8c:A, 7q8c:B, 7q8c:C, 7q8c:D, 7q8c:E, 7q8s:A, 7q8s:C, 7q8s:D, 7q8s:E, 7q8s:F |
8 | 4wjm:A | 312 | 111 | 0.1154 | 0.1058 | 0.2973 | 2.8 | |
9 | 6e60:A | 538 | 68 | 0.0629 | 0.0335 | 0.2647 | 5.2 | 6dmf:A, 6dmf:B, 6dmf:C, 6dmf:D, 6dmf:E, 6dmf:F, 6dmf:G, 6dmf:H, 6dmf:I, 6dmf:J, 6e61:A, 6e61:B, 7nox:A, 7nox:B |
10 | 3ffu:A | 133 | 53 | 0.0699 | 0.1504 | 0.3774 | 5.4 | 3ef5:A, 3ef5:B, 3ffu:B |
11 | 3luf:B | 246 | 48 | 0.0524 | 0.0610 | 0.3125 | 5.6 | 3luf:A, 3mf4:A, 3mf4:B |
12 | 1tll:A | 630 | 53 | 0.0594 | 0.0270 | 0.3208 | 5.8 | 1f20:A, 1tll:B |
13 | 6ly5:a | 742 | 63 | 0.0524 | 0.0202 | 0.2381 | 6.5 | 6l4u:A |
14 | 8zc9:B | 971 | 30 | 0.0385 | 0.0113 | 0.3667 | 6.6 | 8wyb:A, 8wyb:B, 8wyb:C, 8wyb:D, 8wyc:A, 8wyc:B, 8wyf:A, 8wyf:B, 8zc9:E |
15 | 7blz:A | 743 | 68 | 0.0594 | 0.0229 | 0.2500 | 6.9 | 6fos:A, 8wey:A, 5zgb:A, 5zgh:A |
16 | 7svq:A | 315 | 119 | 0.0839 | 0.0762 | 0.2017 | 8.9 | 7svq:B |
17 | 4xpq:A | 670 | 76 | 0.0629 | 0.0269 | 0.2368 | 9.6 | 4xpp:A, 4xps:A |