BioLiP

>protein
TSKWIDISQPLNNDIATWPGDTPFSYEVLWSKEESGSVNVGKLTMSIHTGTHIDAPFHFDNDGKKVLDLDIQVYVGPTRI
IDVSNLESIGKKELEKFHLEGVERLLLRTSSHGKANEFPDIIPHLRADIAPFLSEKGIRLIGVDVPSVDPLDDKELAAHH
QLFKHSIHILENVVLDHVADGDYELIALPLALSDADGSPVRAVIRPI

The query sequence (length=207) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4co9:A	207	207	1.0000	1.0000	1.0000	3.28e-150	4co9:B, 4co9:C, 4co9:D, 4cz1:A, 4cz1:B, 4cz1:C, 4cz1:D
2	4cog:A	207	201	0.4010	0.4010	0.4129	6.94e-52	4cog:B, 4cog:C, 4cog:D
3	4cob:A	206	204	0.4203	0.4223	0.4265	1.25e-50	4cob:B
4	8hmo:A	205	204	0.3043	0.3073	0.3088	2.96e-24	8hmo:B, 8hmo:C, 8hmo:D, 8hmo:E, 8hmo:F
5	1r61:A	205	172	0.2415	0.2439	0.2907	2.23e-17	3krv:B, 1r61:B
6	5nna:D	264	197	0.2609	0.2045	0.2741	8.72e-07	5nna:A, 5nna:B, 5nna:C, 5nnb:A, 5nnb:B, 5nnb:C, 5nnb:D
7	4m8d:D	263	195	0.2560	0.2015	0.2718	8.24e-06	4j0n:A, 4j0n:B, 4m8d:A, 4m8d:B, 4m8d:C, 4m8d:E, 4m8d:F, 4m8d:G, 4m8d:H, 4m8d:I, 4m8d:J, 4m8d:K, 4m8d:L
8	8f9x:A	230	78	0.1159	0.1043	0.3077	6.25e-05	8f9x:B, 8f9x:C, 8f9x:D, 8f9x:E, 8f9x:F, 8f9x:G, 8f9x:H, 8f9x:I, 8f9x:J
9	5nmp:A	265	214	0.2415	0.1887	0.2336	0.003	5nmp:B, 5nmp:C, 5nmp:D, 5nmp:E, 5nmp:F, 5nmp:G, 5nmp:H, 5nmp:I, 5nmp:J
10	3td7:A	253	159	0.1981	0.1621	0.2579	1.6	3gwn:A, 3gwn:B
11	5jc7:A	641	86	0.1159	0.0374	0.2791	3.8
12	6uss:A	485	101	0.1353	0.0577	0.2772	7.6	6uss:B
13	5jc3:A	668	89	0.1111	0.0344	0.2584	8.9	5jc3:B, 5jc7:B, 5jcf:A, 5jcf:B, 5jch:A, 5jch:B

[Back]