BioLiP

>protein
TQPSDWAYIAGAHIVFSYQGQSKTYATRALRVRKESLAAAAANDVSGQWRRNILPKLVPRQLLTTSREVTLEEGWYKELL
AMVRRGVLLEDLTSNVDDDGAITVAIEIKPKWGFLPCAGHLQPPESVSIKSHVSRFRLHQHFRGRADDPPYDPLDLFSGD
KMRMRTALDGLWTMWEISRGKSNNWKVFIGSKEISPDDLQRGLLPMGGDDLVTNITQLTLSALQTSSALPLLKNLQQNLD
PIDISSLAALFQAEHPNSPIFDPDLIAEVSAVELNSFVDIYISDPQAGQRMDSWSLRERIIAYALSAIFKDCSLFVRGVL
KHAWRLVSGGESVKVIDLDLKPVKNIQKWAETDEKVWKHWLKTKGTR

The query sequence (length=367) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5xu6:C	379	377	0.9864	0.9551	0.9602	0.0	5xu6:A, 5xu6:B, 5xu6:D
2	6fl3:B	420	434	0.2916	0.2548	0.2465	2.63e-17	4axc:A, 4axf:A, 6fjk:B, 6fl8:B, 6gfg:B, 6gfg:A, 6gfh:A, 6gfh:B, 4lv7:B, 3udt:A, 3udt:B, 3udz:A, 3udz:B, 2xan:A, 2xao:A
3	4lv7:A	390	426	0.2943	0.2769	0.2535	1.19e-16	3uds:A, 3uds:B
4	4axd:A	433	452	0.3025	0.2564	0.2456	5.51e-16	4aqk:A, 4axe:A, 6fjk:A, 6fl3:A, 6fl8:A, 2xal:A, 2xal:B, 2xam:A, 2xam:B, 2xan:B, 2xao:B, 2xar:A, 2xar:B
5	5mwl:A	421	312	0.2180	0.1900	0.2564	1.93e-11	5mw8:A, 5mwl:B, 5mwm:A
6	4xz6:A	291	162	0.1063	0.1340	0.2407	1.5	4xz6:B
7	1n47:B	233	59	0.0572	0.0901	0.3559	4.0	1n47:A, 1n47:C, 1n47:D
8	6cd1:A	452	35	0.0272	0.0221	0.2857	4.2	6ccz:A, 6ccz:B, 6cd1:B, 6cd1:C, 6cd1:D, 6cd1:E, 6cd1:F, 6cd1:G, 6cd1:H
9	2glf:A	450	57	0.0518	0.0422	0.3333	8.8	2glf:B, 2glf:C, 2glf:D

[Back]