TPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQSIDLHIEIEEQTIGVDVHALGHWFDGRLNLKTSF
EYPWHTAKCHYERDYQTACGLYLDQLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRHVKVCIIGTVSKFS
QGDTLLFFGPLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEFPGSFRKKPICEYDGNMVSGYKKVMATIDSFQSF
NTSTMHFTDERIEWKDPDGMLRDHINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTECPTFLTSI
KACDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFRCCHGEDCSQIGLHAAAPHL
The query sequence (length=376) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ljx:A | 382 | 385 | 0.9920 | 0.9764 | 0.9688 | 0.0 | 5lk2:A, 5lk3:A |
2 | 5ljz:A | 410 | 410 | 1.0000 | 0.9171 | 0.9171 | 0.0 | 5lk1:A |
3 | 7qqb:B | 423 | 405 | 0.6144 | 0.5461 | 0.5704 | 5.10e-171 | |
4 | 6y62:B | 419 | 407 | 0.6277 | 0.5632 | 0.5799 | 2.29e-169 | 6y5f:B, 6zjm:F, 6zjm:H, 6zjm:D, 6zjm:B |
5 | 7pp2:A | 442 | 48 | 0.0319 | 0.0271 | 0.2500 | 0.40 | |
6 | 5ckn:A | 278 | 59 | 0.0399 | 0.0540 | 0.2542 | 1.6 | 5cis:A, 5ckm:A, 5ckn:D, 1nt0:A, 1nt0:G |