TPVKIPILMYHAIHVMSPEETANANLIVNPDLFDQQLQKMKDEGYYFLSPEEVYRALSNNELPAKKVVWLTFDDSMIDFY
NVAYPILKKYDAKATNNVITGLTEMGSAANLTLKQMKEMKQVGMSFQDHTVNHPDLEQASPDVQTTEMKDSKDYLDKQLN
QNTIAIAYPSGRYNDTTLQIAARLNYKLGVTTNEGIASAANGLLSLNRIRILPNMSPENLLQTMEP
The query sequence (length=226) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6dq3:A | 227 | 226 | 1.0000 | 0.9956 | 1.0000 | 5.18e-170 | 6dq3:B |
2 | 4hd5:A | 316 | 231 | 0.3142 | 0.2247 | 0.3074 | 2.05e-18 | 4v33:A, 4v33:B |
3 | 6go1:A | 318 | 223 | 0.2788 | 0.1981 | 0.2825 | 5.20e-16 | 6go1:B |
4 | 4u10:A | 264 | 217 | 0.2345 | 0.2008 | 0.2442 | 3.10e-08 | 4u10:B |
5 | 4wcj:A | 233 | 226 | 0.2257 | 0.2189 | 0.2257 | 6.79e-08 | |
6 | 4f9j:A | 599 | 232 | 0.2345 | 0.0885 | 0.2284 | 5.99e-05 | 4f9d:A, 4f9d:B, 4f9j:B, 4p7n:A, 4p7q:A, 4p7r:A, 3vus:A, 3vus:B |
7 | 2c1g:A | 384 | 116 | 0.1637 | 0.0964 | 0.3190 | 0.003 | 2c1i:A |
8 | 7bly:A | 216 | 121 | 0.1416 | 0.1481 | 0.2645 | 0.003 | |
9 | 2y8u:B | 212 | 122 | 0.1416 | 0.1509 | 0.2623 | 0.031 | 2y8u:A |
10 | 6h8l:B | 206 | 114 | 0.1416 | 0.1553 | 0.2807 | 0.13 | 6h8l:A, 6h8n:A, 6h8n:B |
11 | 2iw0:A | 226 | 83 | 0.1062 | 0.1062 | 0.2892 | 0.14 | |
12 | 8hfa:A | 212 | 73 | 0.0841 | 0.0896 | 0.2603 | 0.46 | 8hfa:B, 8hfa:C, 8hfa:D, 8hfa:E |
13 | 7ax7:A | 205 | 86 | 0.1106 | 0.1220 | 0.2907 | 0.63 | |
14 | 5jmu:A | 220 | 33 | 0.0575 | 0.0591 | 0.3939 | 0.75 | |
15 | 5o6y:A | 214 | 123 | 0.1327 | 0.1402 | 0.2439 | 0.89 | 5o6y:B, 5o6y:C, 5o6y:D |
16 | 3ldf:A | 380 | 48 | 0.0752 | 0.0447 | 0.3542 | 0.95 | |
17 | 4q7r:A | 223 | 72 | 0.0841 | 0.0852 | 0.2639 | 2.2 | 8bgl:A, 8bgl:B, 4q7r:B |
18 | 5n1j:A | 206 | 65 | 0.0929 | 0.1019 | 0.3231 | 3.2 | 5n1j:B, 5n1j:C, 5n1j:D, 5n1p:A, 5n1p:D, 5n1p:B, 5n1p:C, 5nc6:A, 5nc6:B, 5nc6:C, 5nc6:D, 5nc9:A, 5nc9:B, 5nc9:C, 5nc9:D, 5ncd:A, 5ncd:B, 5ncd:C, 5ncd:D, 5nek:A, 5nek:B, 5nek:C, 5nek:D, 5nel:A, 5nel:B, 5nel:C, 5nel:D |
19 | 6hiv:Ab | 453 | 50 | 0.0664 | 0.0331 | 0.3000 | 5.6 | 6hix:Ab |
20 | 8xqw:R | 401 | 65 | 0.0708 | 0.0399 | 0.2462 | 7.2 | 8xqx:R |
21 | 1h3d:A | 288 | 41 | 0.0619 | 0.0486 | 0.3415 | 7.7 | 1q1k:A |
22 | 6p3o:A | 341 | 52 | 0.0664 | 0.0440 | 0.2885 | 7.8 | 6p3m:A, 6p3n:A |