TLSIPPSIQCQTEAACRLITRVTGDTLRAIHLYGSAVAGGLKPNSDIDLLVTICQPLTEAQRATLMQELLALSSPPGASA
EKRALQVTVVLYSQLVPWCFPPSREMQFGEWLREDICQGIYEPAQQDWDMVLLITQILETSIPLKGERAERLFTPAPAAQ
LLKALRYPLDLWQSTADVQGDEYHIVLTLARIWYTLSTGRFTSKDAAADWLLPQLPEDYAATLRAAQREYLGLEQQDWHI
LLPAVVRFVDFAKAHIPTQFTHHH
The query sequence (length=264) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5lpa:A | 267 | 264 | 0.9962 | 0.9850 | 0.9962 | 0.0 | 6fzb:A, 6fzb:B, 5g4a:A, 5g4a:B, 5lpa:B, 5luh:A, 5luh:B |
2 | 7uy4:A | 258 | 249 | 0.4205 | 0.4302 | 0.4458 | 1.71e-69 | 7uy4:B |
3 | 6xz0:A | 250 | 230 | 0.2538 | 0.2680 | 0.2913 | 8.11e-33 | 6xxq:A, 6xxq:B |
4 | 4h44:C | 289 | 79 | 0.0833 | 0.0761 | 0.2785 | 0.11 | 4ogq:C, 1tu2:B, 2zt9:C |
5 | 6tmf:R | 151 | 48 | 0.0644 | 0.1126 | 0.3542 | 0.83 | 6skf:Aq, 6skg:Aq, 6th6:Aq |
6 | 7bxo:E | 125 | 43 | 0.0644 | 0.1360 | 0.3953 | 1.7 | 7aer:A, 7bxo:A, 6m6v:A |
7 | 2e74:C | 288 | 78 | 0.0795 | 0.0729 | 0.2692 | 1.8 | 2d2c:C, 2d2c:P, 2e75:C, 2e76:C, 4h0l:C, 4h13:C, 4i7z:C, 4pv1:C, 1vf5:C, 1vf5:P |
8 | 3c66:A | 529 | 46 | 0.0644 | 0.0321 | 0.3696 | 5.7 | 3c66:B, 1fa0:A, 1fa0:B, 2q66:A |