BioLiP

>protein
TLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVC
TNYKGEASDYATLDVT

The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6h4l:A	96	96	1.0000	1.0000	1.0000	7.04e-70
2	5oyj:C	223	63	0.2083	0.0897	0.3175	5.90e-04
3	5jdj:B	91	75	0.2500	0.2637	0.3200	8.32e-04	5jdj:E, 5jdj:I, 5jdj:L, 4qeg:A
4	1rpq:D	167	90	0.2604	0.1497	0.2778	0.002	1rpq:A, 1rpq:B, 1rpq:C
5	7ok5:A	582	95	0.2812	0.0464	0.2842	0.002	7ok5:B
6	7ok5:A	582	53	0.1771	0.0292	0.3208	0.063	7ok5:B
7	6fey:B	207	81	0.2292	0.1063	0.2716	0.005	6fey:A
8	6iaa:A	815	64	0.2188	0.0258	0.3281	0.010	6iaa:B
9	6iaa:A	815	101	0.2917	0.0344	0.2772	0.011	6iaa:B
10	6iaa:A	815	71	0.2188	0.0258	0.2958	0.53	6iaa:B
11	1djs:A	206	88	0.2292	0.1068	0.2500	0.012	3cu1:C, 3cu1:A, 1e0o:B
12	5k6w:A	475	65	0.2083	0.0421	0.3077	0.024	5k6v:A, 5k6w:B
13	2iep:A	187	91	0.2500	0.1283	0.2637	0.035	2iep:B
14	2iep:A	187	88	0.2396	0.1230	0.2614	0.099	2iep:B
15	7ysu:C	211	85	0.2396	0.1090	0.2706	0.057	7ysu:E
16	7ysh:D	213	88	0.1979	0.0892	0.2159	0.063	1fq9:C, 1fq9:D, 7ysh:E
17	7ysh:D	213	106	0.2708	0.1221	0.2453	3.8	1fq9:C, 1fq9:D, 7ysh:E
18	8edi:A	200	54	0.1875	0.0900	0.3333	0.17	8edi:B
19	5xnp:A	361	90	0.2292	0.0609	0.2444	0.27	5xnp:B, 5xnq:A
20	7ysw:C	213	92	0.2188	0.0986	0.2283	0.30	7ysw:E
21	4x8x:B	393	69	0.2292	0.0560	0.3188	0.59	4x8x:A, 4x9f:A
22	1aoz:A	552	41	0.1875	0.0326	0.4390	0.60	1aoz:B, 1aso:A, 1aso:B, 1asp:A, 1asp:B, 1asq:A, 1asq:B
23	2vra:A	202	74	0.1667	0.0792	0.2162	0.63	2vra:B
24	2yd1:A	196	97	0.2396	0.1173	0.2371	0.79
25	1uf2:A	967	68	0.2083	0.0207	0.2941	0.87
26	8wnf:A	918	76	0.2292	0.0240	0.2895	1.5	8wng:A, 8wni:A, 8wnj:A, 8wo2:A, 8wo3:A
27	6h4f:B	318	48	0.1771	0.0535	0.3542	3.0	6h1j:B, 6h21:A, 6h21:B, 6h21:C, 6h2n:A, 6h2n:B, 6h2n:C, 6h4f:C, 6h4f:F, 6h4f:O, 6h4f:P, 6h4f:E, 6h4f:G, 6h4f:Q, 6h4f:A, 6h4f:D, 6h4f:H, 6h4f:I, 6h4m:B, 6h4m:C, 6h4m:F, 6h4m:O, 6h4m:P, 6h4m:E, 6h4m:G, 6h4m:Q, 6h4m:A, 6h4m:D, 6h4m:H, 6h4m:I, 6hnq:B, 6hnq:C, 6hnq:F, 6hnq:O, 6hnq:P, 6hnq:E, 6hnq:G, 6hnq:Q, 6hnq:A, 6hnq:D, 6hnq:H, 6hnq:I
28	5k6x:A	374	66	0.1875	0.0481	0.2727	3.4	5k6y:A
29	5k3j:A	662	30	0.1042	0.0151	0.3333	4.6	5k3j:B
30	8a3w:SM	102	68	0.2188	0.2059	0.3088	7.3	8a98:SM, 6az1:M, 8ovj:SM, 8rxh:SM, 8rxx:SM, 5t2a:AQ
31	6kc4:A	101	22	0.0938	0.0891	0.4091	7.3	6kc4:C, 6kc4:E, 6kc4:G, 6kc4:I, 6kc4:K
32	8d40:B	427	37	0.0938	0.0211	0.2432	7.5	8d40:A
33	8jw0:f	185	19	0.0729	0.0378	0.3684	8.4

[Back]