BioLiP

>protein
TKVSLVYISLSGNTESFVRRLTDYLLEQHPSLEVEKIHIKDLVKERQPFFEMDNPFIAFLPTYLEGGNGVDNGDVEILTT
DVGDFIAYGQNASKCLGVIGSGNRNFNNQYCLTAKQYSERFGFPVLADFEMRGMLGDIKKVAGIIEELYHIEK

The query sequence (length=153) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4n82:B	153	153	1.0000	1.0000	1.0000	8.83e-113	4n82:A
2	7mmp:E	139	150	0.3072	0.3381	0.3133	7.59e-13	6ebq:A, 6ebq:B, 7mmp:G, 7mmp:F, 7mmp:H, 7mmq:E, 7mmq:F, 7mmq:H, 7mmr:E, 7mmr:G, 7mmr:F, 7mmr:H, 7mms:E, 7mms:G, 7mms:F, 7mms:H
3	3n3a:C	131	147	0.2941	0.3435	0.3061	2.99e-10	3n39:C, 3n39:D, 3n3a:D, 3n3b:C, 3n3b:D
4	7mmq:G	124	147	0.2745	0.3387	0.2857	4.83e-10
5	4bmo:B	118	136	0.2484	0.3220	0.2794	8.91e-07	4bmp:B, 2x2o:A, 2x2p:A, 2xod:A, 2xoe:A, 7z3d:B, 7z3e:B
6	1rlj:A	135	142	0.2353	0.2667	0.2535	0.002
7	5vhe:A	871	81	0.1569	0.0276	0.2963	0.21	6up3:A, 6up4:A, 5vhc:D, 5vhd:D
8	3c01:E	88	25	0.0588	0.1023	0.3600	0.64	3c01:F, 3c01:G, 3c01:H
9	2q5l:A	538	88	0.1699	0.0483	0.2955	1.9	2nxw:A, 2nxw:B, 2q5j:A, 2q5j:B, 2q5l:B, 2q5o:A, 2q5o:B, 2q5q:A, 2q5q:B
10	5lkd:A	352	36	0.0784	0.0341	0.3333	2.2	5lkd:B
11	6qsi:A	525	53	0.1046	0.0305	0.3019	2.4	6qsi:B
12	3cp5:A	116	61	0.1176	0.1552	0.2951	6.0	6cuk:A, 6cun:A
13	6fsg:A	147	63	0.1046	0.1088	0.2540	6.9	6fsi:A, 6ft1:A

[Back]