TKSASSFLDTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGF
SLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQ
IQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNF
EPSTVESTFQDVMK
The query sequence (length=254) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5zr1:B | 374 | 251 | 0.9882 | 0.6711 | 1.0000 | 0.0 | 7mca:B, 6rqc:B, 7tjf:B, 7tjh:B, 7tji:B, 7tjj:B, 7tjk:B, 5v8f:B |
2 | 6wgi:B | 325 | 229 | 0.8898 | 0.6954 | 0.9869 | 1.84e-168 | |
3 | 7jk2:B | 285 | 205 | 0.2323 | 0.2070 | 0.2878 | 2.39e-23 | |
4 | 7jps:B | 199 | 189 | 0.2047 | 0.2613 | 0.2751 | 2.85e-23 | |
5 | 2aaz:A | 305 | 41 | 0.0669 | 0.0557 | 0.4146 | 0.71 | 2aaz:B, 2aaz:C, 2aaz:D, 2aaz:E, 2aaz:F, 2aaz:G, 2aaz:H, 2aaz:I, 2aaz:J, 2aaz:K, 2aaz:L, 2aaz:M, 2aaz:N, 2aaz:O, 2aaz:P |
6 | 3k4y:A | 260 | 30 | 0.0551 | 0.0538 | 0.4667 | 1.3 | 3k4y:B, 3k52:A, 3k52:B, 3k56:A, 3k56:B |
7 | 7oya:11 | 138 | 55 | 0.0551 | 0.1014 | 0.2545 | 7.4 |